Product Information
82923-1-PBS targets S100A16 in WB, FC (Intra), Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag2023 Product name: Recombinant human S100A16 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-103 aa of BC019099 Sequence: MSDCYTELEKAVIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLDANHDGRISFDEYWTLIGGITGPIAKLIHEQEQQSSS Predict reactive species |
| Full Name | S100 calcium binding protein A16 |
| Calculated Molecular Weight | 103 aa, 12 kDa |
| Observed Molecular Weight | 12 kDa |
| GenBank Accession Number | BC019099 |
| Gene Symbol | S100A16 |
| Gene ID (NCBI) | 140576 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q96FQ6 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
S100A16 is a member of the S100 protein family. S100A16 is expressed in a variety of human tissues. S100A16 expression is especially high in tissues rich in epithelial cells. Functionally, S100A16 has been linked to several aspects of tumorigenesis, for example, cell proliferation, differentiation, migration, invasion, and epithelial-mesenchymal transition (EMT).Accordingly, S100A16 has been suggested to have both tumour-promoting and suppressive roles in human cancers. S100A16-mediated cellular functions are suggested to be mediated by the regulation of various signaling pathways/proteins including EMT-related proteins E-cadherin and Vimentin, PI3K-AKT, p53, MMP1-1, MMP-2, MMP-9, JNK/p38, etc. (PMID: 37509106).



