S100A16 Recombinant monoclonal antibody

S100A16 Uni-rAb® Recombinant Antibody for WB, FC (Intra), ELISA
Cat No. 82923-1-RR
Clone No.3E1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), ELISA

3E1, AAG13, Aging-associated gene 13 protein, Protein S100 A16, Protein S100 F

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA431 cells
Positive FC (Intra) detected inA431 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

82923-1-RR targets S100A16 in WB, FC (Intra), ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag2023

Product name: Recombinant human S100A16 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-103 aa of BC019099

Sequence: MSDCYTELEKAVIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLDANHDGRISFDEYWTLIGGITGPIAKLIHEQEQQSSS

Predict reactive species
Full Name S100 calcium binding protein A16
Calculated Molecular Weight 103 aa, 12 kDa
Observed Molecular Weight 12 kDa
GenBank Accession NumberBC019099
Gene Symbol S100A16
Gene ID (NCBI) 140576
RRIDAB_3670658
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ96FQ6
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

S100A16 is a member of the S100 protein family. S100A16 is expressed in a variety of human tissues. S100A16 expression is especially high in tissues rich in epithelial cells. Functionally, S100A16 has been linked to several aspects of tumorigenesis, for example, cell proliferation, differentiation, migration, invasion, and epithelial-mesenchymal transition (EMT).Accordingly, S100A16 has been suggested to have both tumour-promoting and suppressive roles in human cancers. S100A16-mediated cellular functions are suggested to be mediated by the regulation of various signaling pathways/proteins including EMT-related proteins E-cadherin and Vimentin, PI3K-AKT, p53, MMP1-1, MMP-2, MMP-9, JNK/p38, etc. (PMID: 37509106).

Protocols

Product Specific Protocols
FC protocol for S100A16 antibody 82923-1-RRDownload protocol
WB protocol for S100A16 antibody 82923-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...