Tested Applications
| Positive WB detected in | A549 cells, HeLa cells |
| Positive IP detected in | A549 cells |
| Positive IHC detected in | human stomach cancer tissue, human liver cancer tissue, human pancreas cancer tissue, human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | MCF-7 cells |
| Positive FC (Intra) detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:12000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:400-1:1600 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 4 publications below |
| WB | See 15 publications below |
| IHC | See 6 publications below |
| IF | See 7 publications below |
Product Information
10245-1-AP targets S100A6 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat, monkey |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0385 Product name: Recombinant human S100A6 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-90 aa of BC001431 Sequence: MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG Predict reactive species |
| Full Name | S100 calcium binding protein A6 |
| Calculated Molecular Weight | 10 kDa |
| Observed Molecular Weight | 10 kDa |
| GenBank Accession Number | BC001431 |
| Gene Symbol | S100A6 |
| Gene ID (NCBI) | 6277 |
| RRID | AB_2183801 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P06703 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
S100A6 is also named as calcyclin, prolactin receptor-associated protein (PRA), growth factor-inducible protein 2A9 ir MLN4. It belongs to S100 family of low molecular weight, acidic, calcium-binding proteins which contain two EF-hand calcium binding sites. S100A6 may function as a calcium sensor to activate several processes in the calcium signal transduction pathway of cell growth, proliferation, secretion and exocytosis. The antibody is specific for S100A6.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for S100A6 antibody 10245-1-AP | Download protocol |
| IHC protocol for S100A6 antibody 10245-1-AP | Download protocol |
| IP protocol for S100A6 antibody 10245-1-AP | Download protocol |
| WB protocol for S100A6 antibody 10245-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Cell Biol Single-cell reconstruction of the adult human heart during heart failure and recovery reveals the cellular landscape underlying cardiac function. | ||
Sci Transl Med Mutations in the vesicular trafficking protein annexin A11 are associated with amyotrophic lateral sclerosis. | ||
Cancer Lett S100A6 drives lymphatic metastasis of liver cancer via activation of the RAGE/NF-kB/VEGF-D pathway | ||
iScience Lineage tracing reveals transient phenotypic adaptation of tubular cells during acute kidney injury | ||
Cancer Commun (Lond) Candidate therapeutic agents in a newly established triple wild-type mucosal melanoma cell line. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH MALLIKARJUNA (Verified Customer) (10-02-2025) | Good quality product
|





































