• Featured Product
  • KD/KO Validated

CoraLite® Plus 647-conjugated S100A6 Polyclonal antibody

S100A6 Polyclonal Antibody for FC (Intra)
Cat No. CL647-10245

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC (Intra)

2A9, 5B10, CABP, CACY, Calcyclin, MLN 4, PRA, Protein S100 A6, S100A6

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inHeLa cells
Positive FC detected inHeLa cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension
Flow Cytometry (FC)FC : 0.20 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL647-10245 targets S100A6 in FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0385

Product name: Recombinant human S100A6 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-90 aa of BC001431

Sequence: MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG

Predict reactive species
Full Name S100 calcium binding protein A6
Calculated Molecular Weight 10 kDa
Observed Molecular Weight 10 kDa
GenBank Accession NumberBC001431
Gene Symbol S100A6
Gene ID (NCBI) 6277
RRIDAB_2934813
Conjugate CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
Excitation LaserRed Laser (633 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP06703
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

S100A6 is also named as calcyclin, prolactin receptor-associated protein (PRA), growth factor-inducible protein 2A9 ir MLN4. It belongs to S100 family of low molecular weight, acidic, calcium-binding proteins which contain two EF-hand calcium binding sites. S100A6 may function as a calcium sensor to activate several processes in the calcium signal transduction pathway of cell growth, proliferation, secretion and exocytosis. The antibody is specific for S100A6.

Protocols

Product Specific Protocols
FC protocol for CL Plus 647 S100A6 antibody CL647-10245Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...