CoraLite® Plus 488-conjugated S100A6 Polyclonal antibody

• 

  IF Staining of MCF-7 using CL488-10245

  Immunofluorescent analysis of (-20°C Ethanol) fixed MCF-7 cells using CoraLite® Plus 488 S100A6 antibody (CL488-10245) at dilution of 1:200.

• 

  FC experiment of MCF-7 using CL488-10245

  1X10^6 MCF-7 cells were intracellularly stained with 0.4 ug CoraLite® Plus 488 Anti-Human S100A6 (CL488-10245) (red), or 0.4 ug Control Antibody. Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

• Featured Product
• KD/KO Validated

S100A6 Polyclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL488-10245

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra)

Synonyms

PRA, MLN 4, Growth factor-inducible protein 2A9, Calcyclin, CACY

---

Tested Applications

• Positive IF/ICC detected in: MCF-7 cells
• Positive FC (Intra) detected in: MCF-7 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• FC: See 1 publications below

Product Information

CL488-10245 targets S100A6 in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0385

  Product name: Recombinant human S100A6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-90 aa of BC001431

  Sequence: MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG

• Full Name: S100 calcium binding protein A6
• Calculated Molecular Weight: 10 kDa
• GenBank Accession Number: BC001431
• Gene Symbol: S100A6
• Gene ID (NCBI): 6277
• RRID: AB_2918966
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P06703
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

S100A6 is also named as calcyclin, prolactin receptor-associated protein (PRA), growth factor-inducible protein 2A9 ir MLN4. It belongs to S100 family of low molecular weight, acidic, calcium-binding proteins which contain two EF-hand calcium binding sites. S100A6 may function as a calcium sensor to activate several processes in the calcium signal transduction pathway of cell growth, proliferation, secretion and exocytosis. The antibody is specific for S100A6.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	FC	Heliyon; Upregulation of S100A6 and its relation with CD34+ cells apoptosis in high-risk myelodysplastic syndromes patients; Authors - Yan Zhai