Anti-Human S100A8 Rabbit Recombinant Antibody

• 

  FC experiment of human peripheral blood lymphocytes using 98411-3-RR

  1x10^6 human peripheral blood lymphocytes were intracellularly stained with 0.25 ug Anti-Human S100A8 Rabbit RecAb (98411-3-RR, Clone: 242970C4),or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were incubated with FC Receptor Block prior to staining. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• 

  FC experiment of human peripheral blood lymphocytes using 98411-3-RR

  1x10^6 human peripheral blood lymphocytes were intracellularly stained with 0.25 ug Anti-Human S100A8 Rabbit RecAb (98411-3-RR, Clone: 242970C4) (red) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were incubated with FC Receptor Block prior to staining. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

S100A8 Uni-rAb^® Recombinant Antibody for FC (Intra)

Cat No. 98411-3-RR

Clone No.242970C4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC (Intra)

Synonyms

CAGA, Calgranulin A, Calgranulin-A, Calprotectin L1L subunit, CFAG

---

Tested Applications

• Positive FC (Intra) detected in: human peripheral blood lymphocytes

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

98411-3-RR targets S100A8 in FC (Intra) applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3752

  Product name: Recombinant Human S100A8 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 1-93 aa of BC005928

  Sequence: MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE

• Full Name: S100 calcium binding protein A8
• Calculated Molecular Weight: 93 aa, 11 kDa
• GenBank Accession Number: BC005928
• Gene Symbol: S100A8
• Gene ID (NCBI): 6279
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P05109
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Background Information

S100A8 is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and as a cytokine.