Tested Applications
| Positive WB detected in | K-562 cells, MCF-7 cells, LNCaP cells, A549 cells, Hela cells, HepG2 cells, HSC-T6 cells, NIH/3T3 cells |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
67932-1-Ig targets SCAMP3 in WB, IF/ICC, ELISA applications and shows reactivity with Human, rat, mouse samples.
| Tested Reactivity | Human, rat, mouse |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26073 Product name: Recombinant human SCAMP3 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-96 aa of BC000161 Sequence: MAQSRDGGNPFAEPSELDNPFQDPAVIQHRPSRQYATLDVYNPFETREPPPAYEPPAPAPLPPPSAPSLQPSRKLSPTEPKNYGSYSTQASAAAAT Predict reactive species |
| Full Name | secretory carrier membrane protein 3 |
| Calculated Molecular Weight | 38 kDa |
| Observed Molecular Weight | 33 kDa |
| GenBank Accession Number | BC000161 |
| Gene Symbol | SCAMP3 |
| Gene ID (NCBI) | 10067 |
| RRID | AB_2918684 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | O14828 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for SCAMP3 antibody 67932-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |









