SCAMP3 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• SCAMP3 Monoclonal antibody (67932-1-Ig)

SCAMP3 Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 67932-1-Ig Copied!

Clone No. 1C1E6

Publications (1)

Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

Human, rat, mouse

Applications

WB, IF/ICC, ELISA

Synonyms

C1orf3, PROPIN1, SCAMP3

• 

  WB analysis using 67932-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67932-1-Ig (SCAMP3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 67932-1-Ig

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 67932-1-Ig (SCAMP3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of LNCaP using 67932-1-Ig

  LNCaP cells were subjected to SDS PAGE followed by western blot with 67932-1-Ig (SCAMP3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 67932-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67932-1-Ig (SCAMP3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 67932-1-Ig

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using SCAMP3 antibody (67932-1-Ig, Clone: 1C1E6 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SCAMP3 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: K-562 cells, MCF-7 cells, LNCaP cells, A549 cells, Hela cells, HepG2 cells, HSC-T6 cells, NIH/3T3 cells
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67932-1-Ig targets SCAMP3 in WB, IF/ICC, ELISA applications and shows reactivity with Human, rat, mouse samples.

• Tested Reactivity: Human, rat, mouse
• Cited Reactivity: mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26073

  Product name: Recombinant human SCAMP3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-96 aa of BC000161

  Sequence: MAQSRDGGNPFAEPSELDNPFQDPAVIQHRPSRQYATLDVYNPFETREPPPAYEPPAPAPLPPPSAPSLQPSRKLSPTEPKNYGSYSTQASAAAAT

• Full Name: secretory carrier membrane protein 3
• Calculated Molecular Weight: 38 kDa
• Observed Molecular Weight: 33 kDa
• GenBank Accession Number: BC000161
• Gene Symbol: SCAMP3
• Gene ID (NCBI): 10067
• RRID: AB_2918684
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O14828
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The SCAMP3 Monoclonal antibody (1C1E6), catalog number 67932-1-Ig, has a total of 1 citation. It appears in bioRxiv (2025), in a study investigating the copper chaperone ATOX1's differential protein-protein interactions and its role in skeletal myoblast differentiation. The antibody was used for WB and IF applications in mouse samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,IF	bioRxiv; The copper chaperone ATOX1 exhibits differential protein-protein interactions and contributes to skeletal myoblast differentiation.; Authors - Nathan Ferguson