SCAMP3 Monoclonal antibody, PBS Only

• 

  WB analysis using 67932-1-Ig (same clone as 67932-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67932-1-Ig (SCAMP3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67932-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 67932-1-Ig (same clone as 67932-1-PBS)

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 67932-1-Ig (SCAMP3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67932-1-PBS in a different storage buffer formulation.

• 

  WB analysis of LNCaP using 67932-1-Ig (same clone as 67932-1-PBS)

  LNCaP cells were subjected to SDS PAGE followed by western blot with 67932-1-Ig (SCAMP3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67932-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67932-1-Ig (same clone as 67932-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67932-1-Ig (SCAMP3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67932-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 67932-1-Ig (same clone as 67932-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using SCAMP3 antibody (67932-1-Ig, Clone: 1C1E6 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67932-1-PBS in a different storage buffer formulation.

SCAMP3 Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 67932-1-PBS

Clone No.1C1E6

Host / Isotype

Mouse / IgG1

Reactivity

Human, rat, mouse

Applications

WB, IF/ICC, ELISA

Synonyms

C1orf3, PROPIN1, SCAMP3

---

Product Information

67932-1-PBS targets SCAMP3 in WB, IF/ICC, ELISA applications and shows reactivity with Human, rat, mouse samples.

• Tested Reactivity: Human, rat, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26073

  Product name: Recombinant human SCAMP3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-96 aa of BC000161

  Sequence: MAQSRDGGNPFAEPSELDNPFQDPAVIQHRPSRQYATLDVYNPFETREPPPAYEPPAPAPLPPPSAPSLQPSRKLSPTEPKNYGSYSTQASAAAAT

• Full Name: secretory carrier membrane protein 3
• Calculated Molecular Weight: 38 kDa
• Observed Molecular Weight: 33 kDa
• GenBank Accession Number: BC000161
• Gene Symbol: SCAMP3
• Gene ID (NCBI): 10067
• RRID: AB_2918684
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O14828
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.