CoraLite® Plus 488-conjugated SCAMP3 Monoclonal antibody

• 

  IF Staining of HeLa using CL488-67932

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using CoraLite® Plus 488 SCAMP3 antibody (CL488-67932, Clone: 1C1E6 ) at dilution of 1:200.

SCAMP3 Monoclonal Antibody for IF/ICC

Cat No. CL488-67932

Clone No.1C1E6

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

IF/ICC

Synonyms

Secretory carrier-associated membrane protein 3, PROPIN1, C1orf3

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67932 targets SCAMP3 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26073

  Product name: Recombinant human SCAMP3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-96 aa of BC000161

  Sequence: MAQSRDGGNPFAEPSELDNPFQDPAVIQHRPSRQYATLDVYNPFETREPPPAYEPPAPAPLPPPSAPSLQPSRKLSPTEPKNYGSYSTQASAAAAT

• Full Name: secretory carrier membrane protein 3
• Calculated Molecular Weight: 38 kDa
• Observed Molecular Weight: 33 kDa
• GenBank Accession Number: BC000161
• Gene Symbol: SCAMP3
• Gene ID (NCBI): 10067
• RRID: AB_2923832
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O14828
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.