Tested Applications
| Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL488-68096 targets Syntenin-1 in FC (Intra) applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18078 Product name: Recombinant human SDCBP protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 12-139 aa of BC113674 Sequence: VDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQ Predict reactive species |
| Full Name | syndecan binding protein (syntenin) |
| Calculated Molecular Weight | 298 aa, 32 kDa |
| Observed Molecular Weight | 30 kDa |
| GenBank Accession Number | BC113674 |
| Gene Symbol | Syntenin-1 |
| Gene ID (NCBI) | 6386 |
| RRID | AB_3084398 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Excitation Laser | Blue laser (488 nm) |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | O00560 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Syntenin-1, also known as SDCBP (syndecan binding protein) and MDA-9 (melanoma differentiation-associated protein 9), was initially identified as a molecule linking syndecan-mediated signaling to the cytoskeleton. Syntenin-1 is a PDZ-domain-containing molecule that has many interaction partners, and regulates transmembrane-receptor trafficking, cell adhesion, tumor-cell metastasis and neuronal-synapse function. Syntenin-1 is primarily localized to membrane-associated adherens junctions and focal adhesions but is also found at the endoplasmic reticulum and nucleus.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for CL Plus 488 Syntenin-1 antibody CL488-68096 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

