SF4 Recombinant monoclonal antibody

• 

  WB analysis using 87600-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87600-1-RR (SF4 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HepG2 using 87600-1-RR

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using SF4 antibody (87600-1-RR, Clone: 252925A4 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  Affinity of 87600-1-RR

  Biolayer interferometry (BLl) kinetic assays of 87600-1-RR against Human SF4 were performed. The affinity constant is below 1 pM.

SF4 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 87600-1-RR

Clone No.252925A4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

F23858, RNA-binding protein RBP, Splicing factor 4, SUGP1, SURP and G-patch domain-containing protein 1

---

Tested Applications

• Positive WB detected in: U2OS cells, mouse testis tissue, rat testis tissue
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87600-1-RR targets SF4 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag8006

  Product name: Recombinant human SF4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-348 aa of BC002986

  Sequence: LYEPNSQGYKYYRQKLEEFRKAKASSTGSFTAPDPGLKRKSPPEALSGSLPPATTCPASSTPAPTIIPAPAAPGKPASAATVKRKRKSRWGPEEDKVELPPAELVQRDVDASPSPLSVQDLKGLGYEKGKPVGLVGVTELSDAQKKQLKEQQEMQQMYDMIMQHKRAMQDMQLLWEKAVQQHQHGYDSDEEVDSELGTWEHQLRRMEMDKTREWAEQLTKMGRGKHFIGDFLPPDELEKFMETFKALKEGREPDYSEYKEFKLTVENIGYQMLMKMGWKEGEGLGSEGQGIKNPVNKGTTTVDGAGFGIDRPAELSKEDDEYEAFRKRMMLAYRFRPNPLNNPRRPYY

• Full Name: splicing factor 4
• Calculated Molecular Weight: 72 kDa
• Observed Molecular Weight: 72-75 kDa
• GenBank Accession Number: BC002986
• Gene Symbol: SF4
• Gene ID (NCBI): 57794
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8IWZ8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SF4 (Splicing factor 4), also known as SUGP1 (SURP and G-patch domain-containing protein 1) was first identified as a putative splicing factor based on domain composition analysis. SUGP1 protein is predicted to contain two SURP motifs, domains of alternative splicing regulators thought to be involved in RNA binding, as well as a G-patch domain, a region of six highly conserved glycine residues commonly found in eukaryotic RNA-processing proteins (PMID: 27206982). Research has shown that SUGP1 is involved in the regulation of cholesterol metabolism (PMID: 31474574).