SF4 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 87600-1-RR (same clone as 87600-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87600-1-RR (SF4 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87600-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 87600-1-RR (same clone as 87600-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using SF4 antibody (87600-1-RR, Clone: 252925A4 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 87600-1-PBS in a different storage buffer formulation.

• 

  Affinity of 87600-1-RR

  Biolayer interferometry (BLl) kinetic assays of 87600-1-RR against Human SF4 were performed. The affinity constant is below 1 pM.

SF4 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 87600-1-PBS

Clone No.252925A4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

F23858, RNA-binding protein RBP, Splicing factor 4, SUGP1, SURP and G-patch domain-containing protein 1

---

Product Information

87600-1-PBS targets SF4 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag8006

  Product name: Recombinant human SF4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-348 aa of BC002986

  Sequence: LYEPNSQGYKYYRQKLEEFRKAKASSTGSFTAPDPGLKRKSPPEALSGSLPPATTCPASSTPAPTIIPAPAAPGKPASAATVKRKRKSRWGPEEDKVELPPAELVQRDVDASPSPLSVQDLKGLGYEKGKPVGLVGVTELSDAQKKQLKEQQEMQQMYDMIMQHKRAMQDMQLLWEKAVQQHQHGYDSDEEVDSELGTWEHQLRRMEMDKTREWAEQLTKMGRGKHFIGDFLPPDELEKFMETFKALKEGREPDYSEYKEFKLTVENIGYQMLMKMGWKEGEGLGSEGQGIKNPVNKGTTTVDGAGFGIDRPAELSKEDDEYEAFRKRMMLAYRFRPNPLNNPRRPYY

• Full Name: splicing factor 4
• Calculated Molecular Weight: 72 kDa
• Observed Molecular Weight: 72-75 kDa
• GenBank Accession Number: BC002986
• Gene Symbol: SF4
• Gene ID (NCBI): 57794
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8IWZ8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SF4 (Splicing factor 4), also known as SUGP1 (SURP and G-patch domain-containing protein 1) was first identified as a putative splicing factor based on domain composition analysis. SUGP1 protein is predicted to contain two SURP motifs, domains of alternative splicing regulators thought to be involved in RNA binding, as well as a G-patch domain, a region of six highly conserved glycine residues commonly found in eukaryotic RNA-processing proteins (PMID: 27206982). Research has shown that SUGP1 is involved in the regulation of cholesterol metabolism (PMID: 31474574).