Filter: AllWBIPIHCIF-P

WB analysis using 30861-1-AP (same clone as 30861-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 30861-1-AP (SGLT1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30861-1-PBS in a different storage buffer formulation.
WB analysis using 30861-1-AP (same clone as 30861-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 30861-1-AP (SGLT1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30861-1-PBS in a different storage buffer formulation.
WB analysis using 30861-1-AP (same clone as 30861-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 30861-1-AP (SGLT1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30861-1-PBS in a different storage buffer formulation.
WB analysis using 30861-1-AP (same clone as 30861-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 30861-1-AP (SGLT1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30861-1-PBS in a different storage buffer formulation.
IP experiment of mouse kidney using 30861-1-AP (same clone as 30861-1-PBS)
IP result of anti-SGLT1 (IP:30861-1-AP, 4ug; Detection:30861-1-AP 1:400) with mouse kidney tissue lysate 2160 ug. This data was developed using the same antibody clone with 30861-1-PBS in a different storage buffer formulation.
IHC staining of mouse small intestine using 30861-1-AP (same clone as 30861-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse small intestine tissue slide using 30861-1-AP (SGLT1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30861-1-PBS in a different storage buffer formulation.
IHC staining of mouse small intestine using 30861-1-AP (same clone as 30861-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse small intestine tissue slide using 30861-1-AP (SGLT1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30861-1-PBS in a different storage buffer formulation.
IHC staining of mouse small intestine using 30861-1-AP (same clone as 30861-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse small intestine tissue slide using 30861-1-AP (SGLT1 antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30861-1-PBS in a different storage buffer formulation.
IF Staining of mouse small intestine using 30861-1-AP (same clone as 30861-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse small intestine tissue using SGLT1 antibody (30861-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30861-1-PBS in a different storage buffer formulation.

SGLT1 Polyclonal antibody, PBS Only

Name: SGLT1 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 30861-1-PBS

SGLT1 Polyclonal Antibody for WB, IHC, IF-P, IP, Indirect ELISA

Cat No. 30861-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, IP, Indirect ELISA

Synonyms

SLC5A1, High affinity sodium-glucose cotransporter

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

30861-1-PBS targets SGLT1 in WB, IHC, IF-P, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag29338 Product name: Recombinant human SLC5A1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 564-643 aa of NM_000343 Sequence: RNSKEERIDLDAEEENIQEGPKETIEIETQVPEKKKGIFRRAYDLFCGLEQHGAPKMTEEEEKAMKMKMTDTSEKPLWRT Predict reactive species
Full Name	solute carrier family 5 (sodium/glucose cotransporter), member 1
Calculated Molecular Weight	73 kDa
Observed Molecular Weight	73 kDa
GenBank Accession Number	NM_000343
Gene Symbol	SGLT1
Gene ID (NCBI)	6523
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P13866
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

SLC5A1, also known as SGLT1, is a sodium-dependent glucose transporter (SGLT) family member. SGLT1 couples sugar transport to Na+ gradients across the intestinal brush border (PMID: 8563765). SGLT1 mediates active glucose and galactose absorption in the intestine and renal glucose scavenging. Mutations in SGLT1 cause glucose-galactose malabsorption (GGM) syndrome (PMID: 34880492). SGLT1 is expressed in intestine and endometrial cells (PMID: 2490366, 28974690).