SGLT1 Polyclonal antibody

• 

  WB analysis using 30861-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30861-1-AP (SGLT1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 30861-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30861-1-AP (SGLT1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 30861-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30861-1-AP (SGLT1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 30861-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30861-1-AP (SGLT1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse kidney using 30861-1-AP

  IP result of anti-SGLT1 (IP:30861-1-AP, 4ug; Detection:30861-1-AP 1:400) with mouse kidney tissue lysate 2160 ug.

• 

  IHC staining of mouse small intestine using 30861-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse small intestine tissue slide using 30861-1-AP (SGLT1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse small intestine using 30861-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse small intestine tissue slide using 30861-1-AP (SGLT1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse small intestine using 30861-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse small intestine tissue slide using 30861-1-AP (SGLT1 antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse small intestine using 30861-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse small intestine tissue using SGLT1 antibody (30861-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

SGLT1 Polyclonal Antibody for WB, IHC, IF-P, IP, ELISA

Cat No. 30861-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF-P, IP, ELISA

Synonyms

SLC5A1, High affinity sodium-glucose cotransporter

---

Tested Applications

• Positive WB detected in: mouse colon tissue, HeLa cells, 37°C incubated rat kidney tissue, Jurkat cells, Raji cells, mouse kidney tissue, mouse small intestine tissue, rat colon tissue
• Positive IP detected in: mouse kidney tissue
• Positive IHC detected in: mouse small intestine tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse small intestine tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 4 publications below

Product Information

30861-1-AP targets SGLT1 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29338

  Product name: Recombinant human SLC5A1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 564-643 aa of NM_000343

  Sequence: RNSKEERIDLDAEEENIQEGPKETIEIETQVPEKKKGIFRRAYDLFCGLEQHGAPKMTEEEEKAMKMKMTDTSEKPLWRT

• Full Name: solute carrier family 5 (sodium/glucose cotransporter), member 1
• Calculated Molecular Weight: 73 kDa
• Observed Molecular Weight: 73 kDa
• GenBank Accession Number: NM_000343
• Gene Symbol: SGLT1
• Gene ID (NCBI): 6523
• RRID: AB_3669767
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P13866
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SLC5A1, also known as SGLT1, is a sodium-dependent glucose transporter (SGLT) family member. SGLT1 couples sugar transport to Na+ gradients across the intestinal brush border (PMID: 8563765). SGLT1 mediates active glucose and galactose absorption in the intestine and renal glucose scavenging. Mutations in SGLT1 cause glucose-galactose malabsorption (GGM) syndrome (PMID: 34880492). SGLT1 is expressed in intestine and endometrial cells (PMID: 2490366, 28974690).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Food Funct; Procyanidin B1 and p-coumaric acid from whole highland barley ameliorated HFD-induced impaired glucose tolerance via small intestinal barrier and hepatic glucose metabolism; Authors - Zehua Liu
mouse,human	WB	Adv Sci (Weinh); Intestinal Gastrin/CCKBR Axis Protects against Type 2 Diabetes by Reducing Intestinal Glucose Absorption through the PI3K/Akt/eIF4B Signaling Pathway; Authors - Xue Liu
mouse	WB	Biochem Biophys Res Commun; Selenium binding protein 1 (SBP1) suppresses fructose-induced metabolic dysfunction-associated steatotic liver disease; Authors - Takayuki Koga
pig	WB	J Anim Sci; The Inflammatory Injury of Porcine Small Intestinal Epithelial Cells Induced by Deoxynivalenol is Related to the Decrease of Glucose Transport; Authors - Xiaopeng Tang