CoraLite® Plus 488-conjugated SLC25A22 Polyclonal antibody

• 

  IF Staining of mouse brain using CL488-25402

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using CoraLite® Plus 488 SLC25A22 antibody (CL488-25402) at dilution of 1:200.

• 

  IF Staining of mouse brain using CL488-25402

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using CoraLite® Plus 488 SLC25A22 antibody (CL488-25402) at dilution of 1:200.

SLC25A22 Polyclonal Antibody for IF-P

Cat No. CL488-25402

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF-P

Synonyms

FLJ13044, GC 1, GC1, Glutamate/H(+) symporter 1, SLC25A22

---

Tested Applications

• Positive IF-P detected in: mouse brain tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-25402 targets SLC25A22 in IF-P applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19958

  Product name: Recombinant human SLC25A22 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 128-188 aa of BC023545

  Sequence: KIQLQDAGRIAAQRKILAAQGQLSAQGGAQPSVEAPAAPRPTATQLTRDLLRSRGIAGLYK

• Full Name: solute carrier family 25 (mitochondrial carrier: glutamate), member 22
• Calculated Molecular Weight: 323 aa, 34 kDa
• Observed Molecular Weight: 30-34 kDa
• GenBank Accession Number: BC023545
• Gene Symbol: SLC25A22
• Gene ID (NCBI): 79751
• RRID: AB_3084090
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H936
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

SLC25A22 encodes a mitochondrial glutamate/H+ symporter with highly expression in brain, especially in astrocytes, where it controls glutamate uptake. The mutations of SLC25A22 are associated with the early/infantile epileptic encephalopathies. It has been shown that SLC25A22 plays a key role in promoting proliferation and migration in cancer, such as human colorectal cancer (CRC) and Gallbladder cancer (GBC). And there is a result that the expression of SLC25A22 in GBC was significantly higher than that in adjacent tissues. 25402-1-AP antibody is specific to SLC25A22.(PMID: 30814911, 25033742, 24596948)