CoraLite® Plus 488-conjugated SLC25A22 Polyclonal antibody

SLC25A22 Polyclonal Antibody for IF-P
Cat No. CL488-25402

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF-P

FLJ13044, GC 1, GC1, Glutamate/H(+) symporter 1, SLC25A22

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse brain tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-25402 targets SLC25A22 in IF-P applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag19958

Product name: Recombinant human SLC25A22 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 128-188 aa of BC023545

Sequence: KIQLQDAGRIAAQRKILAAQGQLSAQGGAQPSVEAPAAPRPTATQLTRDLLRSRGIAGLYK

Predict reactive species
Full Name solute carrier family 25 (mitochondrial carrier: glutamate), member 22
Calculated Molecular Weight 323 aa, 34 kDa
Observed Molecular Weight 30-34 kDa
GenBank Accession NumberBC023545
Gene Symbol SLC25A22
Gene ID (NCBI) 79751
RRIDAB_3084090
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9H936
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

SLC25A22 encodes a mitochondrial glutamate/H+ symporter with highly expression in brain, especially in astrocytes, where it controls glutamate uptake. The mutations of SLC25A22 are associated with the early/infantile epileptic encephalopathies. It has been shown that SLC25A22 plays a key role in promoting proliferation and migration in cancer, such as human colorectal cancer (CRC) and Gallbladder cancer (GBC). And there is a result that the expression of SLC25A22 in GBC was significantly higher than that in adjacent tissues. 25402-1-AP antibody is specific to SLC25A22.(PMID: 30814911, 25033742, 24596948)

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 SLC25A22 antibody CL488-25402Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...