SLC25A22 Polyclonal antibody

• 

  WB analysis using 25402-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25402-1-AP (SLC25A22 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 25402-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25402-1-AP (SLC25A22 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 25402-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25402-1-AP (SLC25A22 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse brain using 25402-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 25402-1-AP (SLC25A22 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 25402-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 25402-1-AP (SLC25A22 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 25402-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 25402-1-AP (SLC25A22 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 25402-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 25402-1-AP (SLC25A22 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 25402-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 25402-1-AP (SLC25A22 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 25402-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 25402-1-AP (SLC25A22 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse brain using 25402-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using SLC25A22 antibody (25402-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of mouse brain using 25402-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using 25402-1-AP (SLC25A22 antibody) at dilution of 1:50 and CoraLite488-Conjugated Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of COS-7 using 25402-1-AP

  Immunofluorescent analysis of (4% PFA) fixed COS-7 cells using 25402-1-AP (SLC25A22 antibody), at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

SLC25A22 Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, ELISA

Cat No. 25402-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, monkey

Applications

WB, IHC, IF/ICC, IF-P, ELISA

Synonyms

NET44, Glutamate/H(+) symporter 1, GC-1, GC1, GC 1

---

Tested Applications

• Positive WB detected in: mouse brain tissue, Caco-2 cells, HT-29 cells, rat brain tissue, NCI-H1299 cells
• Positive IHC detected in: mouse brain tissue, human colon cancer tissue, human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse brain tissue
• Positive IF/ICC detected in: COS-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

25402-1-AP targets SLC25A22 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, monkey samples.

• Tested Reactivity: human, mouse, rat, monkey
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19958

  Product name: Recombinant human SLC25A22 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 128-188 aa of BC023545

  Sequence: KIQLQDAGRIAAQRKILAAQGQLSAQGGAQPSVEAPAAPRPTATQLTRDLLRSRGIAGLYK

• Full Name: solute carrier family 25 (mitochondrial carrier: glutamate), member 22
• Calculated Molecular Weight: 323 aa, 34 kDa
• Observed Molecular Weight: 30-34 kDa
• GenBank Accession Number: BC023545
• Gene Symbol: SLC25A22
• Gene ID (NCBI): 79751
• RRID: AB_2880060
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H936
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SLC25A22 encodes a mitochondrial glutamate/H+ symporter with highly expression in brain, especially in astrocytes, where it controls glutamate uptake. The mutations of SLC25A22 are associated with the early/infantile epileptic encephalopathies. It has been shown that SLC25A22 plays a key role in promoting proliferation and migration in cancer, such as human colorectal cancer (CRC) and Gallbladder cancer (GBC). And there is a result that the expression of SLC25A22 in GBC was significantly higher than that in adjacent tissues. 25402-1-AP antibody is specific to SLC25A22.(PMID: 30814911, 25033742, 24596948)

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Proc Natl Acad Sci U S A; Dual-process brain mitochondria isolation preserves function and clarifies protein composition.; Authors - Maria F Noterman
human	WB	Cancer Discov; Copper Drives Remodeling of Metabolic State and Progression of Clear Cell Renal Cell Carcinoma; Authors - Megan E Bischoff