SLC25A22 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SLC25A22 Polyclonal antibody (25402-1-AP)

SLC25A22 Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, ELISA

Cat No. 25402-1-AP Copied!

Publications (5)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, monkey and More (1)

Applications

WB, IHC, IF/ICC, IF-P, ELISA

Synonyms

NET44, Glutamate/H(+) symporter 1, GC-1, GC1, GC 1

• 

  WB analysis using 25402-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25402-1-AP (SLC25A22 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 25402-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25402-1-AP (SLC25A22 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 25402-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25402-1-AP (SLC25A22 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 25402-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 25402-1-AP (SLC25A22 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 25402-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 25402-1-AP (SLC25A22 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 25402-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 25402-1-AP (SLC25A22 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 25402-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 25402-1-AP (SLC25A22 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 25402-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 25402-1-AP (SLC25A22 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 25402-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 25402-1-AP (SLC25A22 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse brain using 25402-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using SLC25A22 antibody (25402-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse brain using 25402-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using 25402-1-AP (SLC25A22 antibody) at dilution of 1:50 and CoraLite488-Conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of COS-7 using 25402-1-AP

  Immunofluorescent analysis of (4% PFA) fixed COS-7 cells using 25402-1-AP (SLC25A22 antibody), at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SLC25A22 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse brain tissue, Caco-2 cells, HT-29 cells, rat brain tissue, NCI-H1299 cells
• Positive IHC detected in: mouse brain tissue, human colon cancer tissue, human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse brain tissue
• Positive IF/ICC detected in: COS-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25402-1-AP targets SLC25A22 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, monkey samples.

• Tested Reactivity: human, mouse, rat, monkey
• Cited Reactivity: human, mouse, canine
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19958

  Product name: Recombinant human SLC25A22 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 128-188 aa of BC023545

  Sequence: KIQLQDAGRIAAQRKILAAQGQLSAQGGAQPSVEAPAAPRPTATQLTRDLLRSRGIAGLYK

• Full Name: solute carrier family 25 (mitochondrial carrier: glutamate), member 22
• Calculated Molecular Weight: 323 aa, 34 kDa
• Observed Molecular Weight: 30-34 kDa
• GenBank Accession Number: BC023545
• Gene Symbol: SLC25A22
• Gene ID (NCBI): 79751
• RRID: AB_2880060
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H936
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SLC25A22 encodes a mitochondrial glutamate/H+ symporter with highly expression in brain, especially in astrocytes, where it controls glutamate uptake. The mutations of SLC25A22 are associated with the early/infantile epileptic encephalopathies. It has been shown that SLC25A22 plays a key role in promoting proliferation and migration in cancer, such as human colorectal cancer (CRC) and Gallbladder cancer (GBC). And there is a result that the expression of SLC25A22 in GBC was significantly higher than that in adjacent tissues. 25402-1-AP antibody is specific to SLC25A22.(PMID: 30814911, 25033742, 24596948)

Publications

What published studies show

The SLC25A22 Polyclonal antibody (Cat# 25402-1-AP) has a total of 5 citations. These publications appear in Cancer Discovery, Journal of Clinical Investigation, PNAS, Free Radical Biology and Medicine, and Cell Reports. The associated research fields span cancer biology (renal cell carcinoma), mitochondrial metabolism, neuroscience (brain mitochondria), reproductive biology (placental respiration), and redox biology (ER-mitochondria tethering). All citations used the antibody for Western blot in human, mouse, or canine samples.

Automatically generated from the 5 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cancer Discov; Copper Drives Remodeling of Metabolic State and Progression of Clear Cell Renal Cell Carcinoma; Authors - Megan E Bischoff
canine	WB	J Clin Invest; Alternative splicing of uromodulin enhances mitochondrial metabolism for adaptation to stress in kidney epithelial cells; Authors - Azuma Nanamatsu
mouse	WB	Proc Natl Acad Sci U S A; Dual-process brain mitochondria isolation preserves function and clarifies protein composition.; Authors - Maria F Noterman
mouse	WB	Free Radic Biol Med; Placental mitochondrial respiration is inhibited in mice with trophoblast specific AdipoR2 overexpression.; Authors - Hiroshi Shimada
human	WB	Cell Rep; The ER thioredoxin-related transmembrane protein TMX2 controls redox-mediated tethering of ER-mitochondria contacts.; Authors - Junsheng Chen