Filter:
Tested Applications
| Positive WB detected in | K-562 cells, LNCaP cells, Jurkat cells, Raji cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
67819-1-Ig targets SLC25A42 in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26379 Product name: Recombinant human SLC25A42 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-100 aa of BC045598 Sequence: MGNGVKEGPVRLHEDAEAVLSSSVSSKRDHRQVLSSLLPGALAGALAKTAVAPLDRTKIIFQVSSKRFSAKEAFRVLYYTYLNEGFLSLWRGNSATMVRV Predict reactive species |
| Full Name | solute carrier family 25, member 42 |
| Calculated Molecular Weight | 318 aa, 35 kDa |
| Observed Molecular Weight | 30-35 kDa |
| GenBank Accession Number | BC045598 |
| Gene Symbol | SLC25A42 |
| Gene ID (NCBI) | 284439 |
| RRID | AB_2918582 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q86VD7 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for SLC25A42 antibody 67819-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
