SLC25A42 Monoclonal antibody, PBS Only

• 

  WB analysis of K-562 using 67819-1-Ig (same clone as 67819-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 67819-1-Ig (SLC25A42 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67819-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67819-1-Ig (same clone as 67819-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67819-1-Ig (SLC25A42 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67819-1-PBS in a different storage buffer formulation.

SLC25A42 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 67819-1-PBS

Clone No.2F7G10

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

Mitochondrial coenzyme A transporter SLC25A42

---

Product Information

67819-1-PBS targets SLC25A42 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26379

  Product name: Recombinant human SLC25A42 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-100 aa of BC045598

  Sequence: MGNGVKEGPVRLHEDAEAVLSSSVSSKRDHRQVLSSLLPGALAGALAKTAVAPLDRTKIIFQVSSKRFSAKEAFRVLYYTYLNEGFLSLWRGNSATMVRV

• Full Name: solute carrier family 25, member 42
• Calculated Molecular Weight: 318 aa, 35 kDa
• Observed Molecular Weight: 30-35 kDa
• GenBank Accession Number: BC045598
• Gene Symbol: SLC25A42
• Gene ID (NCBI): 284439
• RRID: AB_2918582
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q86VD7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.