SLC26A2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SLC26A2 Polyclonal antibody (27759-1-AP)

SLC26A2 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 27759-1-AP Copied!

Publications (6)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

Synonyms

DTD, DTDST

• 

  WB analysis of mouse colon using 27759-1-AP

  mouse colon tissue were subjected to SDS PAGE followed by western blot with 27759-1-AP (SLC26A2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat colon using 27759-1-AP

  rat colon tissue were subjected to SDS PAGE followed by western blot with 27759-1-AP (SLC26A2 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 27759-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 27759-1-AP (SLC26A2 antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 27759-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 27759-1-AP (SLC26A2 antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 27759-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 27759-1-AP (SLC26A2 antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 27759-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 27759-1-AP (SLC26A2 antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 27759-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using SLC26A2 antibody (27759-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of U2OS using 27759-1-AP

  1X10^6 U2OS cells were intracellularly stained with 0.4 ug Anti-Human SLC26A2 (27759-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SLC26A2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse colon tissue, rat colon tissue
• Positive IHC detected in: human colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells
• Positive FC (Intra) detected in: U2OS cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:2000-1:8000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27759-1-AP targets SLC26A2 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, canine
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26521

  Product name: Recombinant human SLC26A2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-112 aa of BC059390

  Sequence: MSSESKEQHNVSPRDSAEGNDSYPSGIHLELQRESSTDFKQFETNDQCRPYHRILIERQEKSDTNFKEFVIKKLQKNCQCSPAKAKNMILGFLPVLQWLPKYDLKKNILGDV

• Full Name: solute carrier family 26 (sulfate transporter), member 2
• Calculated Molecular Weight: 82 kDa
• Observed Molecular Weight: 68 kDa
• GenBank Accession Number: BC059390
• Gene Symbol: SLC26A2
• Gene ID (NCBI): 1836
• RRID: AB_2880963
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P50443
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The SLC26A2 Polyclonal antibody (Cat# 27759-1-AP) has 6 citations published in Cell Stem Cell, Nature Communications, Journal of Experimental Medicine, Biomaterials Research, iScience, and PLoS One. The research fields span intestinal biology (nutrient absorption, mucosal barrier repair), stem cell/organoid engineering, osteoarthritis and lipid metabolism, drug delivery/biomaterials, and ulcerative colitis. Applications cited include IF and WB in human, mouse, and canine samples.

Automatically generated from the 6 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Cell Stem Cell; Bioengineered human colon organoids with in vivo-like cellular complexity and function; Authors - Olga Mitrofanova
		Nat Commun; Oxysterol undersulfation promotes osteoarthritis by fueling chondrocyte lipid accumulation.; Authors - Huanbo Wang
human	IF	J Exp Med; Single-cell transcriptome analysis reveals differential nutrient absorption functions in human intestine.; Authors - Yalong Wang
mouse,human,canine	IF	Biomater Res; ι-Carrageenan nanocomposites for enhanced stability and oral bioavailability of curcumin.; Authors - Joo Young Lee
human	WB	iScience; Integrative analysis reveals marker genes for intestinal mucosa barrier repairing in clinical patients; Authors - Xiao-Hu Zhao
human	WB	PLoS One; Screening and validation of 3'-Methoxydaidzein as a therapeutic agent in ulcerative colitis based on disulfidptosis-associated molecular clusters; Authors - Jie Yuan