Tested Applications
Positive WB detected in | mouse colon tissue, rat colon tissue |
Positive IHC detected in | human colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HepG2 cells |
Positive FC (Intra) detected in | U2OS cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunohistochemistry (IHC) | IHC : 1:2000-1:8000 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 2 publications below |
IF | See 3 publications below |
Product Information
27759-1-AP targets SLC26A2 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, canine |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag26521 Product name: Recombinant human SLC26A2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-112 aa of BC059390 Sequence: MSSESKEQHNVSPRDSAEGNDSYPSGIHLELQRESSTDFKQFETNDQCRPYHRILIERQEKSDTNFKEFVIKKLQKNCQCSPAKAKNMILGFLPVLQWLPKYDLKKNILGDV Predict reactive species |
Full Name | solute carrier family 26 (sulfate transporter), member 2 |
Calculated Molecular Weight | 82 kDa |
Observed Molecular Weight | 68 kDa |
GenBank Accession Number | BC059390 |
Gene Symbol | SLC26A2 |
Gene ID (NCBI) | 1836 |
RRID | AB_2880963 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P50443 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for SLC26A2 antibody 27759-1-AP | Download protocol |
IHC protocol for SLC26A2 antibody 27759-1-AP | Download protocol |
IF protocol for SLC26A2 antibody 27759-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Biomater Res ι-Carrageenan nanocomposites for enhanced stability and oral bioavailability of curcumin. | ||
J Exp Med Single-cell transcriptome analysis reveals differential nutrient absorption functions in human intestine. | ||
iScience Integrative analysis reveals marker genes for intestinal mucosa barrier repairing in clinical patients | ||
Cell Stem Cell Bioengineered human colon organoids with in vivo-like cellular complexity and function | ||
PLoS One Screening and validation of 3'-Methoxydaidzein as a therapeutic agent in ulcerative colitis based on disulfidptosis-associated molecular clusters |