SLC26A2 Polyclonal antibody

• 

  WB analysis of mouse colon using 27759-1-AP

  mouse colon tissue were subjected to SDS PAGE followed by western blot with 27759-1-AP (SLC26A2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat colon using 27759-1-AP

  rat colon tissue were subjected to SDS PAGE followed by western blot with 27759-1-AP (SLC26A2 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon using 27759-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 27759-1-AP (SLC26A2 antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon using 27759-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 27759-1-AP (SLC26A2 antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon using 27759-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 27759-1-AP (SLC26A2 antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human colon using 27759-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 27759-1-AP (SLC26A2 antibody) at dilution of 1:200 (under 40x lens).

• 

  IF Staining of HepG2 using 27759-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using SLC26A2 antibody (27759-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  FC experiment of U2OS using 27759-1-AP

  1X10^6 U2OS cells were intracellularly stained with 0.4 ug Anti-Human SLC26A2 (27759-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

SLC26A2 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 27759-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

Synonyms

DTD, DTDST

---

Tested Applications

• Positive WB detected in: mouse colon tissue, rat colon tissue
• Positive IHC detected in: human colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells
• Positive FC (Intra) detected in: U2OS cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:2000-1:8000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IF: See 3 publications below

Product Information

27759-1-AP targets SLC26A2 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, canine
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26521

  Product name: Recombinant human SLC26A2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-112 aa of BC059390

  Sequence: MSSESKEQHNVSPRDSAEGNDSYPSGIHLELQRESSTDFKQFETNDQCRPYHRILIERQEKSDTNFKEFVIKKLQKNCQCSPAKAKNMILGFLPVLQWLPKYDLKKNILGDV

• Full Name: solute carrier family 26 (sulfate transporter), member 2
• Calculated Molecular Weight: 82 kDa
• Observed Molecular Weight: 68 kDa
• GenBank Accession Number: BC059390
• Gene Symbol: SLC26A2
• Gene ID (NCBI): 1836
• RRID: AB_2880963
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P50443
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human,canine	IF	Biomater Res; ι-Carrageenan nanocomposites for enhanced stability and oral bioavailability of curcumin.; Authors - Joo Young Lee
human	IF	J Exp Med; Single-cell transcriptome analysis reveals differential nutrient absorption functions in human intestine.; Authors - Yalong Wang
human	WB	iScience; Integrative analysis reveals marker genes for intestinal mucosa barrier repairing in clinical patients; Authors - Xiao-Hu Zhao
human	IF	Cell Stem Cell; Bioengineered human colon organoids with in vivo-like cellular complexity and function; Authors - Olga Mitrofanova
human	WB	PLoS One; Screening and validation of 3'-Methoxydaidzein as a therapeutic agent in ulcerative colitis based on disulfidptosis-associated molecular clusters; Authors - Jie Yuan