Tested Applications
Positive FC (Intra) detected in | U2OS cells |
Recommended dilution
Application | Dilution |
---|---|
Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
CL488-27759 targets SLC26A2 in FC (Intra) applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag26521 Product name: Recombinant human SLC26A2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-112 aa of BC059390 Sequence: MSSESKEQHNVSPRDSAEGNDSYPSGIHLELQRESSTDFKQFETNDQCRPYHRILIERQEKSDTNFKEFVIKKLQKNCQCSPAKAKNMILGFLPVLQWLPKYDLKKNILGDV Predict reactive species |
Full Name | solute carrier family 26 (sulfate transporter), member 2 |
Calculated Molecular Weight | 82 kDa |
Observed Molecular Weight | 68 kDa |
GenBank Accession Number | BC059390 |
Gene Symbol | SLC26A2 |
Gene ID (NCBI) | 1836 |
RRID | AB_3672816 |
Conjugate | CoraLite® Plus 488 Fluorescent Dye |
Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P50443 |
Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Protocols
Product Specific Protocols | |
---|---|
FC protocol for CL Plus 488 SLC26A2 antibody CL488-27759 | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |