GLUT1 Recombinant monoclonal antibody

GLUT1 Uni-rAb® Recombinant Antibody for WB, IHC, FC (Intra), ELISA

Cat No. 81463-1-RR
Clone No.6F14

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, FC (Intra), ELISA

SLC2A1, GLUT-1, SLC2A1,GLUT1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inunboiled HEK-293 cells, 37°C incubated HeLa cells
Positive IHC detected inhuman skin cancer tissue, human placenta tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inHeLa cells

For optimal WB detection with 81463-1-RR, we recommend to avoid boiling the sample after lysis.

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

81463-1-RR targets GLUT1 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag16282

Product name: Recombinant human SLC2A1,GLUT1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 216-280 aa of BC121804

Sequence: INRNEENRAKSVLKKLRGTADVTHDLQEMKEESRQMMREKKVTILELFRSPAYRQPILIAVVLQL

Predict reactive species
Full Name solute carrier family 2 (facilitated glucose transporter), member 1
Calculated Molecular Weight 492 aa, 54 kDa
Observed Molecular Weight 45-55 kDa
GenBank Accession NumberBC121804
Gene Symbol GLUT1
Gene ID (NCBI) 6513
RRIDAB_2923718
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP11166
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GLUT1, also known as SLC2A1, is a ubiquitously expressed glucose transporter and is responsible for the basal level of glucose uptake in most cell types. Human erythrocytes express the highest level of GLUT1. Defects in SLC2A1 are the cause of GLUT1 deficiency syndrome type 1 and type 2. High expression of GLUT1 has been reported to be a reliable immunohistochemical marker for juvenile hemangiomas. GLUT1 protein may appear as two or more distinct forms among 43 kDa to 55 kDa due to the different glycosylation states. And the conversion of the highly glycosylated form of GLUT1 to a less glycosylated form has been reported to correlate with differentiation (PMID: 8263524, 23302780).

Protocols

Product Specific Protocols
FC protocol for GLUT1 antibody 81463-1-RRDownload protocol
IHC protocol for GLUT1 antibody 81463-1-RRDownload protocol
WB protocol for GLUT1 antibody 81463-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
WB

Int J Biol Macromol

Glyphosate targets FYN to regulate glycolysis and promote glioblastoma proliferation: A network toxicology study

Authors - Anquan Ma
humanWB

Br J Cancer

Relationship between the expression of PD-L1 and 18F-FDG uptake in pancreatic ductal adenocarcinoma

Authors - Jiajin Li
mouse,humanWB,IHC

Cell Death Dis

Scutellarin activates IDH1 to exert antitumor effects in hepatocellular carcinoma progression

Authors - Zhao Cui
Loading...
||
New chat

Able

正在加载,请稍候...