CoraLite® Plus 488-conjugated SLC30A2 Monoclonal antibody

SLC30A2 Monoclonal Antibody for FC (Intra)
Cat No. CL488-67993
Clone No.1D9E5

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

FC (Intra)

1D9E5, PP12488, Proton-coupled zinc antiporter SLC30A2, ZnT 2, ZNT2

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67993 targets SLC30A2 in FC (Intra) applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag8232

Product name: Recombinant human SLC30A2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 234-323 aa of BC006251

Sequence: KGVDFTAVRDLLLSVEGVEALHSLHIWALTVAQPVLSVHIAIAQNTDAQAVLKTASSRLQGKFHFHTVTIQIEDYSEDMKDCQACQGPSD

Predict reactive species
Full Name solute carrier family 30 (zinc transporter), member 2
Calculated Molecular Weight 323 aa, 35 kDa
Observed Molecular Weight41 kDa
GenBank Accession NumberBC006251
Gene Symbol SLC30A2
Gene ID (NCBI) 7780
RRIDAB_3084390
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9BRI3
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

SLC30A2, also named as the Zn transporter 2 gene (ZnT2), belongs to the cation diffusion facilitator (CDF) transporter (TC 2.A.4) family and SLC30A subfamily. It plays a role in the zinc ion transmembrane transport. Expression of SLC30A2 is restricted to secretory cells, such as acinar pancreatic cells, prostate epithelial cells, placental trophoblasts, Paneth cells, and mammary epithelial cells (MECs). SLC30A2 consists of six transmembrane domains with cytoplasmic N- and C-termini that contain numerous regulatory domains, and functions as a homo- or hetero- dimer to transport Zn into vesicles (PMID: 29476070 ). SLC30A2 has 2 isoforms with the molecular mass of 35 and 41 kDa.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 SLC30A2 antibody CL488-67993Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...