Tested Applications
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL488-67993 targets SLC30A2 in FC (Intra) applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag8232 Product name: Recombinant human SLC30A2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 234-323 aa of BC006251 Sequence: KGVDFTAVRDLLLSVEGVEALHSLHIWALTVAQPVLSVHIAIAQNTDAQAVLKTASSRLQGKFHFHTVTIQIEDYSEDMKDCQACQGPSD Predict reactive species |
| Full Name | solute carrier family 30 (zinc transporter), member 2 |
| Calculated Molecular Weight | 323 aa, 35 kDa |
| Observed Molecular Weight | 41 kDa |
| GenBank Accession Number | BC006251 |
| Gene Symbol | SLC30A2 |
| Gene ID (NCBI) | 7780 |
| RRID | AB_3084390 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q9BRI3 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
SLC30A2, also named as the Zn transporter 2 gene (ZnT2), belongs to the cation diffusion facilitator (CDF) transporter (TC 2.A.4) family and SLC30A subfamily. It plays a role in the zinc ion transmembrane transport. Expression of SLC30A2 is restricted to secretory cells, such as acinar pancreatic cells, prostate epithelial cells, placental trophoblasts, Paneth cells, and mammary epithelial cells (MECs). SLC30A2 consists of six transmembrane domains with cytoplasmic N- and C-termini that contain numerous regulatory domains, and functions as a homo- or hetero- dimer to transport Zn into vesicles (PMID: 29476070 ). SLC30A2 has 2 isoforms with the molecular mass of 35 and 41 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for CL Plus 488 SLC30A2 antibody CL488-67993 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

