SLC6A12 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 83195-5-RR (same clone as 83195-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83195-5-RR (SLC6A12 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83195-5-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83195-5-PBS

  Biolayer interferometry (BLl) kinetic assays of 83195-5-RR against Human SLC6A12 were performed. The affinity constant is below 1 pM.

SLC6A12 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 83195-5-PBS

Clone No.240021C10

Host / Isotype

Rabbit / IgG

Reactivity

Human

Applications

WB, Indirect ELISA

Synonyms

BGT 1, BGT1, FLJ38727, SLC6A12

---

Product Information

83195-5-PBS targets SLC6A12 in WB, Indirect ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag18778

  Product name: Recombinant human SLC6A12 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 548-614 aa of BC126215

  Sequence: VCVPLFVVITLLKTRGPFRKRLRQLITPDSSLPQPKQHPCLDGSAGRNFGPSPTREGLIAGEKETHL

• Full Name: solute carrier family 6 (neurotransmitter transporter, betaine/GABA), member 12
• Calculated Molecular Weight: 614 aa, 69 kDa
• GenBank Accession Number: BC126215
• Gene Symbol: SLC6A12
• Gene ID (NCBI): 6539
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P48065
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.