Tested Applications
Positive WB detected in | HepG2 cells, HuH-7 cells, MCF-7 cells, HEK-293T cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:5000-1:50000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
83195-5-RR targets SLC6A12 in WB, ELISA applications and shows reactivity with Human samples.
Tested Reactivity | Human |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Ag18778 Product name: Recombinant human SLC6A12 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 548-614 aa of BC126215 Sequence: VCVPLFVVITLLKTRGPFRKRLRQLITPDSSLPQPKQHPCLDGSAGRNFGPSPTREGLIAGEKETHL Predict reactive species |
Full Name | solute carrier family 6 (neurotransmitter transporter, betaine/GABA), member 12 |
Calculated Molecular Weight | 614 aa, 69 kDa |
Observed Molecular Weight | 69 kDa |
GenBank Accession Number | BC126215 |
Gene Symbol | SLC6A12 |
Gene ID (NCBI) | 6539 |
RRID | AB_3670885 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purfication |
UNIPROT ID | P48065 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for SLC6A12 antibody 83195-5-RR | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |