SLC6A7 Recombinant monoclonal antibody, PBS Only

• 

  IHC staining of mouse brain using 83412-4-RR (same clone as 83412-4-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 83412-4-RR (SLC6A7 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83412-4-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 83412-4-RR (same clone as 83412-4-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 83412-4-RR (SLC6A7 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83412-4-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 83412-4-RR (same clone as 83412-4-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 83412-4-RR (SLC6A7 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83412-4-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 83412-4-RR (same clone as 83412-4-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 83412-4-RR (SLC6A7 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83412-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83412-4-RR

  Biolayer interferometry (BLl) kinetic assays of 83412-4-RR against Human SLC6A7 were performed. The affinity constant is below 1 pM.

SLC6A7 Uni-rAb^® Recombinant Antibody for IHC, ELISA

Cat No. 83412-4-PBS

Clone No.240395H5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, ELISA

Synonyms

Sodium-dependent proline transporter, PROT, 240395H5

---

Product Information

83412-4-PBS targets SLC6A7 in IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag34413

  Product name: Recombinant human SLC6A7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 138-214 aa of BC093785

  Sequence: AYVLFYLFASLTSDLPWEHCGNWWNTELCLEHRVSKDGNGALPLNLTCTVSPSEEYWSRYVLHIQGSQGIGSPGEIR

• Full Name: solute carrier family 6 (neurotransmitter transporter, L-proline), member 7
• Calculated Molecular Weight: 636 aa, 71 kDa
• GenBank Accession Number: BC093785
• Gene Symbol: SLC6A7
• Gene ID (NCBI): 6534
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q99884
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SLC6A7 also known as PROT, belongs to the solute Carrier 6 gene family. SLC6A7 is a high-affinity mammalian brain L-proline transporter, which is different from other sodium-dependent plasma membrane carriers, and has unique pharmacological specificity, kinetic properties, and ionic requirements. SLC6A7 is a brain specific sodium (and chloride)-dependent proline transporter, that terminates the action of proline by its high affinity sodium-dependent reuptake into presynaptic terminals(PMID: 7651355).