SMG5 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SMG5 Polyclonal antibody, PBS Only (12694-1-PBS)

• 

  IHC staining of mouse heart using 12694-1-AP (same clone as 12694-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 12694-1-AP (SMG5 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12694-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 12694-1-AP (same clone as 12694-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using SMG5 antibody (12694-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-Phalloidin (red). This data was developed using the same antibody clone with 12694-1-PBS in a different storage buffer formulation.

• 

  IF Staining of Jurkat using 12694-1-AP (same clone as 12694-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed Jurkat cells using SMG5 antibody (12694-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-Phalloidin (red). This data was developed using the same antibody clone with 12694-1-PBS in a different storage buffer formulation.

SMG5 Polyclonal Antibody for IHC, IF/ICC, Indirect ELISA

Cat No. 12694-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF/ICC, Indirect ELISA

Synonyms

EST1 like protein B, EST1B, EST1-like protein B, hSMG 5, hSMG-5

---

Product Information

12694-1-PBS targets SMG5 in IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3424

  Product name: Recombinant human SMG5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 670-1016 aa of BC038296

  Sequence: DLIIVCAQSSQSLWNRLSVLLNLLPAAGELQESGLALCPEVQDLLEGCELPDLPSSLLLPEDMALRNLPPLRAAHRRFNFDTDRPLLSTLEESVVRICCIRSFGHFIARLQGSILQFNPEVGIFVSIAQSEQESLLQQAQAQFRMAQEEARRNRLMRDMAQLRLQLEVSQLEGSLQQPKAQSAMSPYLVPDTQALCHHLPVIRQLATSGRFIVIIPRTVIDGLDLLKKEHPGARDGIRYLEAEFKKGNRYIRCQKEVGKSFERHKLKRQDADAWTLYKILDSCKQLTLAQGAGEEDPSGMVTIITGLPLDNPSVLSGPMQAALQAAAHASVDIKDVLDFYKQWKEIG

• Full Name: Smg-5 homolog, nonsense mediated mRNA decay factor (C. elegans)
• Calculated Molecular Weight: 1016 aa, 114 kDa
• GenBank Accession Number: BC038296
• Gene Symbol: SMG5
• Gene ID (NCBI): 23381
• RRID: AB_2270781
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UPR3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SMG5 is also named EST1-like protein B (EST1B) and LPTS-RP1. SMG5 is a key Nonsense-mediated mRNA decay (NMD) factor, and NMD factor SMG5 is vital for embryonic development (PMID: 39199410). SMG5 plays a role in the degradation of mRNA through the process of nonsense-mediated decay and encodes a protein. SMG5 has been linked to the development of pancreatic cancer and epiphyseal chondrodysplasia among various illnesses (PMID: 36056355). SMG5 is a kind of RNA-binding proteins (RBPs) (PMID: 37936239). In addition, they have been shown to be key regulators of oncogenesis and tumor progression (PMID: 33228611). SMG5 may be a high-risk factor for HCC prognosis (PMID: 33411682). SMG5 promotes HCC cell proliferation and tumor growth. SMG5 has extensive effects on the proliferation, survival, and tumor growth of HCC cells.