SMG5 Polyclonal antibody

• 

  IHC staining of mouse heart using 12694-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 12694-1-AP (SMG5 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of MCF-7 using 12694-1-AP

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using SMG5 antibody (12694-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-Phalloidin (red).

• 

  IF Staining of Jurkat using 12694-1-AP

  Immunofluorescent analysis of (4% PFA) fixed Jurkat cells using SMG5 antibody (12694-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-Phalloidin (red).

SMG5 Polyclonal Antibody for IHC, IF/ICC, ELISA

Cat No. 12694-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

KIAA1089, hSMG-5, hSMG 5, EST1-like protein B, EST1B

---

Tested Applications

• Positive IHC detected in: mouse heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: MCF-7 cells, Jurkat cells

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below

Product Information

12694-1-AP targets SMG5 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3424

  Product name: Recombinant human SMG5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 670-1016 aa of BC038296

  Sequence: DLIIVCAQSSQSLWNRLSVLLNLLPAAGELQESGLALCPEVQDLLEGCELPDLPSSLLLPEDMALRNLPPLRAAHRRFNFDTDRPLLSTLEESVVRICCIRSFGHFIARLQGSILQFNPEVGIFVSIAQSEQESLLQQAQAQFRMAQEEARRNRLMRDMAQLRLQLEVSQLEGSLQQPKAQSAMSPYLVPDTQALCHHLPVIRQLATSGRFIVIIPRTVIDGLDLLKKEHPGARDGIRYLEAEFKKGNRYIRCQKEVGKSFERHKLKRQDADAWTLYKILDSCKQLTLAQGAGEEDPSGMVTIITGLPLDNPSVLSGPMQAALQAAAHASVDIKDVLDFYKQWKEIG

• Full Name: Smg-5 homolog, nonsense mediated mRNA decay factor (C. elegans)
• Calculated Molecular Weight: 1016 aa, 114 kDa
• GenBank Accession Number: BC038296
• Gene Symbol: SMG5
• Gene ID (NCBI): 23381
• RRID: AB_2270781
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UPR3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Sci Rep; Identification of nonsense-mediated mRNA decay pathway as a critical regulator of p53 isoform β.; Authors - Lauren E Cowen
human	WB	Sci Rep; Characterization of SMG7 14-3-3-like domain reveals phosphoserine binding-independent regulation of p53 and UPF1.; Authors - Lauren E Cowen
human	WB	Sci Rep; Critical role of SMG7 in activation of the ATR-CHK1 axis in response to genotoxic stress.; Authors - Kathleen Ho