Use Able AI chat for product recommendations

SMMHC Polyclonal antibody

SMMHC Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA

MYH11, KIAA0866, Myosin 11, Myosin heavy chain 11, Myosin-11

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for SMMHC in ?

Tested Applications

Positive WB detected inmouse uterus tissue
Positive IHC detected inhuman colon tissue, human skeletal muscle tissue, rat bladder tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse heart tissue
Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inC2C12 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

21404-1-AP targets SMMHC in WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag16114

Product name: Recombinant human MYH11 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1208-1316 aa of BC104906

Sequence: LTEQLEQFKRAKANLDKNKQTLEKENADLAGELRVLGQAKQEVEHKKKKLEAQVQELQSKCSDGERARAELNDKVHKLQNEVESVTGMLNEAEGKAIKLAKDVASLSSQ

Predict reactive species
Full Name myosin, heavy chain 11, smooth muscle
Calculated Molecular Weight 1979 aa, 228 kDa
Observed Molecular Weight 220 kDa
GenBank Accession NumberBC104906
Gene Symbol SMMHC/MYH11
Gene ID (NCBI) 4629
RRIDAB_10732819
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP35749
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SMMHC (smooth muscle myosin heavy chain; MYH11) is a contractile protein of smooth muscle cells. It is specifically expressed in cells derived from smooth muscle lineages. SMMHC is used as vascular smooth muscle cell (vSMC) contractile marker. It is also an excellent marker for myoepithelial cells, with no or few cross-reaction with myofibroblasts, thus very useful in the evaluation of stromal invasion.

Protocols

Product Specific Protocols
FC protocol for SMMHC antibody 21404-1-APDownload protocol
IF protocol for SMMHC antibody 21404-1-APDownload protocol
IHC protocol for SMMHC antibody 21404-1-APDownload protocol
WB protocol for SMMHC antibody 21404-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Anti-MYH11 antibody (Cat# 21404-1-AP) has 76 total citations in journals including Nature Communications, Nature Aging, Science Advances, Journal of Clinical Investigation, Cardiovascular Research, FASEB Journal, Theranostics, and over 50 others. Research fields span cardiovascular diseases (atherosclerosis, aortic aneurysm/dissection, pulmonary hypertension), vascular smooth muscle cell phenotypic switching and remodeling, cancer metastasis, neurology, urology, and developmental biology. Main applications are WB, IF, and IHC in human, mouse, and rat.

SpeciesApplicationTitle
humanIF

Cancer Commun (Lond)

Tryptophan 2,3-dioxygenase-positive matrix fibroblasts fuel breast cancer lung metastasis via kynurenine-mediated ferroptosis resistance of metastatic cells and T cell dysfunction

Authors - Yongcan Liu
mouseIF

Nat Aging

Senescent cells suppress innate smooth muscle cell repair functions in atherosclerosis.

Authors - Bennett G Childs
humanWB

Nat Commun

Poly(ADP-ribose) polymerase 1 accelerates vascular calcification by upregulating Runx2.

Authors - Cheng Wang

Nat Commun

Pericytes promote metastasis by regulating tumor local vascular tone and hemodynamics

Authors - Xiaobo Li
mouseWB

Redox Biol

Activation of nuclear receptor pregnane-X-receptor protects against abdominal aortic aneurysm by inhibiting oxidative stress

Authors - Zhi Shen
mouseWB

Theranostics

Salvia miltiorrhiza-derived miRNAs suppress vascular remodeling through regulating OTUD7B/KLF4/NMHC IIA axis.

Authors - Gao-Shan Yang

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

Based on the available reviews, 21404-1-AP has received a 5-star rating from a user who described it as "one of the best smooth muscle cell markers for immunofluorescence." The review was posted in July 2023 and highlights its strong performance in IF applications. Overall, customer feedback is highly positive, with users praising its effectiveness as a smooth muscle marker.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Tom (Verified Customer) (07-12-2023)

One of the best smooth muscle cell markers for immunofluorescence!!

  • Applications: Immunofluorescence
Loading...
||
New chat

Able™

正在加载,请稍候...