SNAPIN Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SNAPIN Polyclonal antibody (10055-1-AP)

SNAPIN Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 10055-1-AP Copied!

Publications (17)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

Biogenesis of lysosome-related organelles complex 1 subunit 7, BLOC-1 subunit 7, BLOC1S7, SNAP associated protein, SNAP25BP

• 

  WB analysis of A375 using 10055-1-AP

  A375 cells were subjected to SDS PAGE followed by western blot with 10055-1-AP (SNAPIN Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat brain using 10055-1-AP

  rat brain tissue were subjected to SDS PAGE followed by western blot with 10055-1-AP (SNAPIN Antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 10055-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 10055-1-AP (SNAPIN Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse brain using 10055-1-AP

  IP result of anti-SNAPIN (IP:10055-1-AP, 5ug; Detection:10055-1-AP 1:300) with mouse brain tissue lysate 4000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 10055-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 10055-1-AP (SNAPIN Antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 10055-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 10055-1-AP (SNAPIN Antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human brain using 10055-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 10055-1-AP (SNAPIN Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human brain using 10055-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 10055-1-AP (SNAPIN Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 10055-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using SNAPIN antibody (10055-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 10055-1-AP

  Immunofluorescent analysis of HepG2 cells using 10055-1-AP (SNAPIN antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SNAPIN in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A375 cells, HEK-293 cells, rat brain tissue
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: human testis tissue, human brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10055-1-AP targets SNAPIN in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0101

  Product name: Recombinant human SNAPIN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-136 aa of BC000761

  Sequence: MAGAGSAAVSGAGTPVAGPTGRDLFAEGLLEFLRPAVQQLDSHVHAVRESQVELREQIDNLATELCRINEDQKVALDLDPYVKKLLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGIYPPGSPGK

• Full Name: SNAP-associated protein
• Calculated Molecular Weight: 15 kDa
• Observed Molecular Weight: 15-18 kDa
• GenBank Accession Number: BC000761
• Gene Symbol: SNAPIN
• Gene ID (NCBI): 23557
• RRID: AB_2192656
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95295
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Snapin, a protein of relative molecular weight of 15kd, is implicated in neurotransmission by binding to SNAP-25. Snapin was enriched in neurons and exclusively located on synaptic vesicle membrane, which may be a PKA target for modulating transmitter release through the cAMP-dependent signal-transduction pathway. This anitbody can recognize the 15-18kd(Monomer) and 30-36kd(Dimer) forms of SNAPIN.

Publications

What published studies show

SNAPIN Polyclonal antibody (Cat# 10055-1-AP) has 17 citations across journals including Autophagy, NPJ Parkinson's Disease, American Journal of Human Genetics, Journal of Cell Biology, Molecular Cell Proteomics, Frontiers in Endocrinology, Journal of Thrombosis and Haemostasis, Cancer Science, Skeletal Muscle, Pigment Cell & Melanoma Research, Reproduction, Traffic, eLife, and bioRxiv. Research fields span lysosomal biology, autophagy, neurodegeneration, platelet disorders, pancreatic β-cell growth, hepatocellular carcinoma, muscular dystrophy, Hermansky-Pudlak syndrome, spermatogenesis, and HIV-associated neurological damage.

Automatically generated from the 17 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Autophagy; Carbon nanotubes, but not spherical nanoparticles, block autophagy by a shape-related targeting of lysosomes in murine macrophages.; Authors - Vanessa Cohignac
human	WB,IF	Autophagy; SNAPIN is critical for lysosomal acidification and autophagosome maturation in macrophages.; Authors - Bo Shi
human	WB	Autophagy; HIV-1 Vpr protein impairs lysosome clearance causing SNCA/alpha-synuclein accumulation in neurons.; Authors - Maryline Santerre
rat	WB	NPJ Parkinsons Dis; Disruption of axonal transport in Parkinson's disease: the role of pathological α-Syn and AMPK/p38 MAPK signaling; Authors - Xiaoman Yang
human	WB	Am J Hum Genet; A BLOC-1 mutation screen reveals that PLDN is mutated in Hermansky-Pudlak Syndrome type 9.; Authors - Cullinane Andrew R AR
human	IF	Mol Cell Proteomics; Interaction Proteomics of Polycystins 1 and 2 Reveal a Novel Role for the BLOC-1/BORC Lysosomal Positioning Complex.; Authors - Fatima Lukmani