SNAPIN Polyclonal antibody

• 

  WB analysis of A375 using 10055-1-AP

  A375 cells were subjected to SDS PAGE followed by western blot with 10055-1-AP (SNAPIN Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat brain using 10055-1-AP

  rat brain tissue were subjected to SDS PAGE followed by western blot with 10055-1-AP (SNAPIN Antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 10055-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 10055-1-AP (SNAPIN Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse brain using 10055-1-AP

  IP result of anti-SNAPIN (IP:10055-1-AP, 5ug; Detection:10055-1-AP 1:300) with mouse brain tissue lysate 4000ug.

• 

  IHC staining of human testis using 10055-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 10055-1-AP (SNAPIN Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human testis using 10055-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 10055-1-AP (SNAPIN Antibody) at dilution of 1:200 (under 40x lens).

• 

  IHC staining of human brain using 10055-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 10055-1-AP (SNAPIN Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human brain using 10055-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 10055-1-AP (SNAPIN Antibody) at dilution of 1:50 (under 40x lens).

• 

  IF Staining of HepG2 using 10055-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using SNAPIN antibody (10055-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of HepG2 using 10055-1-AP

  Immunofluorescent analysis of HepG2 cells using 10055-1-AP (SNAPIN antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

SNAPIN Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 10055-1-AP

Publications(14)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

Biogenesis of lysosome-related organelles complex 1 subunit 7, BLOC-1 subunit 7, BLOC1S7, SNAP associated protein, SNAP25BP

---

Tested Applications

• Positive WB detected in: A375 cells, HEK-293 cells, rat brain tissue
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: human testis tissue, human brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 12 publications below
• IHC: See 2 publications below
• IF: See 2 publications below

Product Information

10055-1-AP targets SNAPIN in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0101

  Product name: Recombinant human SNAPIN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-136 aa of BC000761

  Sequence: MAGAGSAAVSGAGTPVAGPTGRDLFAEGLLEFLRPAVQQLDSHVHAVRESQVELREQIDNLATELCRINEDQKVALDLDPYVKKLLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGIYPPGSPGK

• Full Name: SNAP-associated protein
• Calculated Molecular Weight: 15 kDa
• Observed Molecular Weight: 15-18 kDa
• GenBank Accession Number: BC000761
• Gene Symbol: SNAPIN
• Gene ID (NCBI): 23557
• RRID: AB_2192656
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95295
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Snapin, a protein of relative molecular weight of 15kd, is implicated in neurotransmission by binding to SNAP-25. Snapin was enriched in neurons and exclusively located on synaptic vesicle membrane, which may be a PKA target for modulating transmitter release through the cAMP-dependent signal-transduction pathway. This anitbody can recognize the 15-18kd(Monomer) and 30-36kd(Dimer) forms of SNAPIN.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human		J Thromb Haemost; Dysregulation of PLDN (pallidin) is a mechanism for platelet dense granule deficiency in RUNX1 haplodeficiency.; Authors - G F Mao
human	WB	Am J Hum Genet; A BLOC-1 mutation screen reveals that PLDN is mutated in Hermansky-Pudlak Syndrome type 9.; Authors - Cullinane Andrew R AR
mouse	WB	Autophagy; Carbon nanotubes, but not spherical nanoparticles, block autophagy by a shape-related targeting of lysosomes in murine macrophages.; Authors - Vanessa Cohignac
human	WB	Autophagy; HIV-1 Vpr protein impairs lysosome clearance causing SNCA/alpha-synuclein accumulation in neurons.; Authors - Maryline Santerre
human	WB,IF	Autophagy; SNAPIN is critical for lysosomal acidification and autophagosome maturation in macrophages.; Authors - Bo Shi
human	WB	J Cell Biol; LAMTOR/Ragulator is a negative regulator of Arl8b- and BORC-dependent late endosomal positioning.; Authors - Przemyslaw A Filipek