• KD/KO Validated

CoraLite® Plus 488-conjugated SOX10 Monoclonal antibody

SOX10 Monoclonal Antibody for IF-P, FC (Intra)

Cat No. CL488-66786
Clone No.1D2C8

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

IF-P, FC (Intra)

Transcription factor SOX-10, Transcription factor SOX 10, SRY-box transcription factor 9, PCWH, DOM

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse brain tissue, rat brain tissue
Positive FC (Intra) detected inC6 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66786 targets SOX10 in IF-P, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag23191

Product name: Recombinant human SOX10 protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 267-466 aa of BC002824

Sequence: GKPHIDFGNVDIGEISHEVMSNMETFDVAELDQYLPPNGHPGHVSSYSAAGYGLGSALAVASGHSAWISKPPGVALPTVSPPGVDAKAQVKTETAGPQGPPHYTDQPSTSQIAYTSLSLPHYGSAFPSISRPQFDYSDHQPSGPYYGHSGQASGLYSAFSYMGPSQRPLYTAISDPSPSGPQSHSPTHWEQPVYTTLSRP

Predict reactive species
Full Name SRY (sex determining region Y)-box 10
Calculated Molecular Weight 50 kDa
GenBank Accession NumberBC002824
Gene Symbol SOX10
Gene ID (NCBI) 6663
RRIDAB_2919369
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP56693
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Sox10 is a transcription factor that has a crucial role in complex signalling pathways regulating central nervous system and neural crest development. The calcualted molecular weight of SOX10 is 50 kDa, but modified SOX10 is about 55-60 kDa. (PMID: 23799842)

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 SOX10 antibody CL488-66786Download protocol
IF protocol for CL Plus 488 SOX10 antibody CL488-66786Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...