• Featured Product
  • KD/KO Validated

SOX9 Monoclonal antibody

SOX9 Monoclonal Antibody for WB, FC (Intra), ELISA
Cat No. 67439-1-Ig
Clone No.1H9A6

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse and More (4)

Applications

WB, FC (Intra), ELISA

1H9A6, CMD1, CMPD1, SRA1, Transcription factor SOX 9

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHT-29 cells, Caco-2 cells, human placenta tissue, NCCIT cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67439-1-Ig targets SOX9 in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat, pig, rabbit, canine
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28620

Product name: Recombinant human SOX9 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 209-509 aa of BC007951

Sequence: ADSPHSSSGMSEVHSPGEHSGQSQGPPTPPTTPKTDVQPGKADLKREGRPLPEGGRQPPIDFRDVDIGELSSDVISNIETFDVNEFDQYLPPNGHPGVPATHGQVTYTGSYGISSTAATPASAGHVWMSKQQAPPPPPQQPPQAPPAPQAPPQPQAAPPQQPAAPPQQPQAHTLTTLSSEPGQSQRTHIKTEQLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSYPPITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQLTRP

Predict reactive species
Full Name SRY (sex determining region Y)-box 9
Calculated Molecular Weight 509 aa, 56 kDa
Observed Molecular Weight 56 kDa
GenBank Accession NumberBC007951
Gene Symbol SOX9
Gene ID (NCBI) 6662
RRIDAB_2882675
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP48436
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SOX9, also named as Transcription factor SOX-9, is a 509 amino acid protein. Sex-determining region Y (SRY)-box 9 protein (SOX9) is a member of the SOX family of transcription factors (TFs) which are developmental regulators that possess high mobility group (HMG) box DNA binding and transactivation domains. It participates in a variety of functions, such as lineage restriction and terminal diferentiation, through precise temporal and spatial expression patterns that difer between particular cell types and tissues. SOX9 gene has been implicated in different types of cancer as an oncogene; however, it also may behave as a tumor suppressor.

Protocols

Product Specific Protocols
FC protocol for SOX9 antibody 67439-1-IgDownload protocol
WB protocol for SOX9 antibody 67439-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
rat,mouse

Bioact Mater

Synergizing adaptive immunity and regenerative signals to enhance osteochondral defects repair

Authors - Changjian Lin
humanWB

Sci Transl Med

Single-cell atlas of human infrapatellar fat pad and synovium implicates APOE signaling in osteoarthritis pathology

Authors - Su'an Tang
rat,humanWB

Adv Sci (Weinh)

Mechanical Load-Induced Upregulation of Talin2 through Non-Canonical Deubiquitination of OTUB1 Drives Facet Joint Osteoarthritis Pathogenesis

Authors - Yizhen Huang
ratWB

Adv Sci (Weinh)

DNA Origami-Based CD44-Targeted Therapy Silences Stat3 Enhances Cartilage Regeneration and Alleviates Osteoarthritis Progression

Authors - Qi Lv
mouse,humanWB

Theranostics

Histone H3K27 methyltransferase EZH2 regulates apoptotic and inflammatory responses in sepsis-induced AKI

Authors - Bojun Li
humanWB

Mater Today Bio

Platelet-derived extracellular vesicles ameliorate intervertebral disc degeneration by alleviating mitochondrial dysfunction

Authors - Zhanqiu Dai

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Iram (Verified Customer) (09-18-2025)

Very good antibody for IB, IHC and IF.

  • Applications: Western Blot, Immunohistochemistry, Immunofluorescence
  • Primary Antibody Dilution: 1:1000 for IB, 1:250 for IHC and 1:200for IF
  • Cell Tissue Type: CRC cells and tissues
FH

Agustina (Verified Customer) (09-13-2025)

With this dilution the cells included as positive control (PC3 cells) had a good signal, however not much in the PDXs, even though it seems some was there (could be related with decalcification or other sample processing steps). I will try increasing the antibody concentration.

  • Applications: Immunohistochemistry
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Human PDXs growing in mice femur, PC3 cell line pellet and PC3 subcutaneous tumor.
Loading...
||
New chat Able
正在加载,请稍候...