SOX9 Monoclonal antibody

• 

  WB analysis using 67439-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67439-1-Ig (SOX9 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control.

• 

  WB analysis of human placenta using 67439-1-Ig

  human placenta tissue were subjected to SDS PAGE followed by western blot with 67439-1-Ig (SOX9 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Caco-2 using 67439-1-Ig

  Caco-2 cells were subjected to SDS PAGE followed by western blot with 67439-1-Ig (SOX9 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HT-29 using 67439-1-Ig

  HT-29 cells were subjected to SDS PAGE followed by western blot with 67439-1-Ig (SOX9 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of NCCIT using 67439-1-Ig

  NCCIT cells were subjected to SDS PAGE followed by western blot with 67439-1-Ig (SOX9 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HT-29 using 67439-1-Ig

  HT-29 cells were subjected to SDS PAGE followed by western blot with 67439-1-Ig (SOX9 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human gliomas using 67439-1-Ig

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 67439-1-Ig (SOX9 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  FC experiment of HeLa using 67439-1-Ig

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug Anti-Human SOX9 (67439-1-Ig, Clone:1H9A6) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Mouse IgG1 Isotype Control (MOPC-21) (65124-1-Ig, Clone: MOPC-21) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

• Featured Product
• KD/KO Validated

SOX9 Monoclonal Antibody for WB, FC (Intra), ELISA

Cat No. 67439-1-Ig

Clone No.1H9A6

Publications(89)

Reviews (2)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse and More (4)

Applications

WB, FC (Intra), ELISA

Synonyms

1H9A6, CMD1, CMPD1, SRA1, Transcription factor SOX 9

---

Tested Applications

• Positive WB detected in: HT-29 cells, Caco-2 cells, human placenta tissue, NCCIT cells
• Positive IHC detected in: human gliomas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 69 publications below

Product Information

67439-1-Ig targets SOX9 in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat, pig, rabbit, canine
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28620

  Product name: Recombinant human SOX9 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 209-509 aa of BC007951

  Sequence: ADSPHSSSGMSEVHSPGEHSGQSQGPPTPPTTPKTDVQPGKADLKREGRPLPEGGRQPPIDFRDVDIGELSSDVISNIETFDVNEFDQYLPPNGHPGVPATHGQVTYTGSYGISSTAATPASAGHVWMSKQQAPPPPPQQPPQAPPAPQAPPQPQAAPPQQPAAPPQQPQAHTLTTLSSEPGQSQRTHIKTEQLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSYPPITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQLTRP

• Full Name: SRY (sex determining region Y)-box 9
• Calculated Molecular Weight: 509 aa, 56 kDa
• Observed Molecular Weight: 56 kDa
• GenBank Accession Number: BC007951
• Gene Symbol: SOX9
• Gene ID (NCBI): 6662
• RRID: AB_2882675
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P48436
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SOX9, also named as Transcription factor SOX-9, is a 509 amino acid protein. Sex-determining region Y (SRY)-box 9 protein (SOX9) is a member of the SOX family of transcription factors (TFs) which are developmental regulators that possess high mobility group (HMG) box DNA binding and transactivation domains. It participates in a variety of functions, such as lineage restriction and terminal diferentiation, through precise temporal and spatial expression patterns that difer between particular cell types and tissues. SOX9 gene has been implicated in different types of cancer as an oncogene; however, it also may behave as a tumor suppressor.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat,mouse		Bioact Mater; Synergizing adaptive immunity and regenerative signals to enhance osteochondral defects repair; Authors - Changjian Lin
human	WB	Sci Transl Med; Single-cell atlas of human infrapatellar fat pad and synovium implicates APOE signaling in osteoarthritis pathology; Authors - Su'an Tang
rat,human	WB	Adv Sci (Weinh); Mechanical Load-Induced Upregulation of Talin2 through Non-Canonical Deubiquitination of OTUB1 Drives Facet Joint Osteoarthritis Pathogenesis; Authors - Yizhen Huang
rat	WB	Adv Sci (Weinh); DNA Origami-Based CD44-Targeted Therapy Silences Stat3 Enhances Cartilage Regeneration and Alleviates Osteoarthritis Progression; Authors - Qi Lv
mouse,human	WB	Theranostics; Histone H3K27 methyltransferase EZH2 regulates apoptotic and inflammatory responses in sepsis-induced AKI; Authors - Bojun Li
human	WB	Mater Today Bio; Platelet-derived extracellular vesicles ameliorate intervertebral disc degeneration by alleviating mitochondrial dysfunction; Authors - Zhanqiu Dai

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Iram (Verified Customer) (09-18-2025)

Very good antibody for IB, IHC and IF.

• Applications: Western Blot, Immunohistochemistry, Immunofluorescence
• Primary Antibody Dilution: 1:1000 for IB, 1:250 for IHC and 1:200for IF
• Cell Tissue Type: CRC cells and tissues

FH

Agustina (Verified Customer) (09-13-2025)

With this dilution the cells included as positive control (PC3 cells) had a good signal, however not much in the PDXs, even though it seems some was there (could be related with decalcification or other sample processing steps). I will try increasing the antibody concentration.

• Applications: Immunohistochemistry
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: Human PDXs growing in mice femur, PC3 cell line pellet and PC3 subcutaneous tumor.