SOX9 Monoclonal antibody, PBS Only

• 

  WB analysis using 67439-1-Ig (same clone as 67439-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67439-1-Ig (SOX9 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 67439-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human placenta using 67439-1-Ig (same clone as 67439-1-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 67439-1-Ig (SOX9 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67439-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NCCIT using 67439-1-Ig (same clone as 67439-1-PBS)

  NCCIT cells were subjected to SDS PAGE followed by western blot with 67439-1-Ig (SOX9 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67439-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HT-29 using 67439-1-Ig (same clone as 67439-1-PBS)

  HT-29 cells were subjected to SDS PAGE followed by western blot with 67439-1-Ig (SOX9 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67439-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Caco-2 using 67439-1-Ig (same clone as 67439-1-PBS)

  Caco-2 cells were subjected to SDS PAGE followed by western blot with 67439-1-Ig (SOX9 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67439-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HT-29 using 67439-1-Ig (same clone as 67439-1-PBS)

  HT-29 cells were subjected to SDS PAGE followed by western blot with 67439-1-Ig (SOX9 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67439-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 67439-1-Ig (same clone as 67439-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 67439-1-Ig (SOX9 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67439-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 67439-1-Ig (same clone as 67439-1-PBS)

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug Anti-Human SOX9 (67439-1-Ig, Clone:1H9A6) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Mouse IgG1 Isotype Control (MOPC-21) (65124-1-Ig, Clone: MOPC-21) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 67439-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

SOX9 Monoclonal Antibody for WB, FC (Intra), ELISA

Cat No. 67439-1-PBS

Clone No.1H9A6

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, FC (Intra), ELISA

Synonyms

1H9A6, CMD1, CMPD1, SRA1, Transcription factor SOX 9

---

Product Information

67439-1-PBS targets SOX9 in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28620

  Product name: Recombinant human SOX9 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 209-509 aa of BC007951

  Sequence: ADSPHSSSGMSEVHSPGEHSGQSQGPPTPPTTPKTDVQPGKADLKREGRPLPEGGRQPPIDFRDVDIGELSSDVISNIETFDVNEFDQYLPPNGHPGVPATHGQVTYTGSYGISSTAATPASAGHVWMSKQQAPPPPPQQPPQAPPAPQAPPQPQAAPPQQPAAPPQQPQAHTLTTLSSEPGQSQRTHIKTEQLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSYPPITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQLTRP

• Full Name: SRY (sex determining region Y)-box 9
• Calculated Molecular Weight: 509 aa, 56 kDa
• Observed Molecular Weight: 56 kDa
• GenBank Accession Number: BC007951
• Gene Symbol: SOX9
• Gene ID (NCBI): 6662
• RRID: AB_2882675
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P48436
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SOX9, also named as Transcription factor SOX-9, is a 509 amino acid protein. Sex-determining region Y (SRY)-box 9 protein (SOX9) is a member of the SOX family of transcription factors (TFs) which are developmental regulators that possess high mobility group (HMG) box DNA binding and transactivation domains. It participates in a variety of functions, such as lineage restriction and terminal diferentiation, through precise temporal and spatial expression patterns that difer between particular cell types and tissues. SOX9 gene has been implicated in different types of cancer as an oncogene; however, it also may behave as a tumor suppressor.