• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated SOX9 Monoclonal antibody

SOX9 Monoclonal Antibody for FC (Intra)
Cat No. CL488-67439
Clone No.1H9A6

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

FC (Intra)

Transcription factor SOX-9, Transcription factor SOX 9, SRA1, CMPD1, CMD1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67439 targets SOX9 in FC (Intra) applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28620

Product name: Recombinant human SOX9 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 209-509 aa of BC007951

Sequence: ADSPHSSSGMSEVHSPGEHSGQSQGPPTPPTTPKTDVQPGKADLKREGRPLPEGGRQPPIDFRDVDIGELSSDVISNIETFDVNEFDQYLPPNGHPGVPATHGQVTYTGSYGISSTAATPASAGHVWMSKQQAPPPPPQQPPQAPPAPQAPPQPQAAPPQQPAAPPQQPQAHTLTTLSSEPGQSQRTHIKTEQLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSYPPITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQLTRP

Predict reactive species
Full Name SRY (sex determining region Y)-box 9
Calculated Molecular Weight 509 aa, 56 kDa
Observed Molecular Weight 56 kDa
GenBank Accession NumberBC007951
Gene Symbol SOX9
Gene ID (NCBI) 6662
RRIDAB_3084349
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP48436
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

SOX9, also named as Transcription factor SOX-9, is a 509 amino acid protein. Sex-determining region Y (SRY)-box 9 protein (SOX9) is a member of the SOX family of transcription factors (TFs) which are developmental regulators that possess high mobility group (HMG) box DNA binding and transactivation domains. It participates in a variety of functions, such as lineage restriction and terminal diferentiation, through precise temporal and spatial expression patterns that difer between particular cell types and tissues. SOX9 gene has been implicated in different types of cancer as an oncogene; however, it also may behave as a tumor suppressor.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 SOX9 antibody CL488-67439Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...