• Featured Product
  • KD/KO Validated

SPAG5 Polyclonal antibody

SPAG5 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA
Cat No. 14726-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IP, ELISA

sperm associated antigen 5, Mitotic spindle-associated protein p126, MAP126, hMAP126, Deepest

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, HeLa cells, K-562 cells, PC-3 cells
Positive IP detected inHeLa cells
Positive IHC detected inhuman testis tissue, mouse testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14726-1-AP targets SPAG5 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag6485

Product name: Recombinant human SPAG5 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 844-1193 aa of BC000322

Sequence: TVENLTAKLASTIADNQEQDLEKTRQYSQKLGLLTEQLQSLTLFLQTKLKEKTEQETLLLSTACPPTQEHPLPNDRTFLGSILTAVADEEPESTPVPLLGSDKSAFTRVASMVSLQPAETPGMEESLAEMSIMTTELQSLCSLLQESKEEAIRTLQRKICELQARLQAQEEQHQEVQKAKEADIEKLNQALCLRYKNEKELQEVIQQQNEKILEQIDKSGELISLREEVTHLTRSLRRAETETKVLQEALAGQLDSNCQPMATNWIQEKVWLSQEVDKLRVMFLEMKNEKEKLMIKFQSHRNILEENLRRSDKELEKLDDIVQHIYKTLLSIPEVVRGCKELQGLLEFLS

Predict reactive species
Full Name sperm associated antigen 5
Calculated Molecular Weight 134 kDa
Observed Molecular Weight 135 kDa, 150 kDa
GenBank Accession NumberBC000322
Gene Symbol SPAG5
Gene ID (NCBI) 10615
RRIDAB_2194787
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ96R06
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SPAG5, also named as MAP126, Astrin and Deepest, is necessary for normal spindle formation during mitosis. It is highly expressed in testis. SPAG5 has different localization in somatic versus male germ cells suggesting the possibility of different function. This antibody is specific to SPAG5.

Protocols

Product Specific Protocols
IF protocol for SPAG5 antibody 14726-1-APDownload protocol
IHC protocol for SPAG5 antibody 14726-1-APDownload protocol
IP protocol for SPAG5 antibody 14726-1-APDownload protocol
WB protocol for SPAG5 antibody 14726-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouse,humanWB,IF

Nat Commun

CDC20B is required for deuterosome-mediated centriole production in multiciliated cells.

Authors - Diego R Revinski
humanWB, IP, IF

Elife

Centriolar satellites assemble centrosomal microcephaly proteins to recruit CDK2 and promote centriole duplication.

Authors - Andrew Kodani
  • KD Validated
humanWB

Elife

Kinetochores attached to microtubule-ends are stabilised by Astrin bound PP1 to ensure proper chromosome segregation.

Authors - Duccio Conti
humanWB,IP

Elife

CLUH controls astrin-1 expression to couple mitochondrial metabolism to cell cycle progression.

Authors - Désirée Schatton
mouseIHC,IF

Elife

DIAPH3 deficiency links microtubules to mitotic errors, defective neurogenesis, and brain dysfunction.

Authors - Eva On-Chai Lau
humanWB,IHC

J Nanobiotechnology

Fe-doped chrysotile nanotubes containing siRNAs to silence SPAG5 to treat bladder cancer.

Authors - Jianye Liu
Loading...
||
New chat Able
正在加载,请稍候...