Tested Applications
| Positive WB detected in | A549 cells, HeLa cells, K-562 cells, PC-3 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human testis tissue, mouse testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 5 publications below |
| WB | See 14 publications below |
| IHC | See 5 publications below |
| IF | See 9 publications below |
| IP | See 2 publications below |
Product Information
14726-1-AP targets SPAG5 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6485 Product name: Recombinant human SPAG5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 844-1193 aa of BC000322 Sequence: TVENLTAKLASTIADNQEQDLEKTRQYSQKLGLLTEQLQSLTLFLQTKLKEKTEQETLLLSTACPPTQEHPLPNDRTFLGSILTAVADEEPESTPVPLLGSDKSAFTRVASMVSLQPAETPGMEESLAEMSIMTTELQSLCSLLQESKEEAIRTLQRKICELQARLQAQEEQHQEVQKAKEADIEKLNQALCLRYKNEKELQEVIQQQNEKILEQIDKSGELISLREEVTHLTRSLRRAETETKVLQEALAGQLDSNCQPMATNWIQEKVWLSQEVDKLRVMFLEMKNEKEKLMIKFQSHRNILEENLRRSDKELEKLDDIVQHIYKTLLSIPEVVRGCKELQGLLEFLS Predict reactive species |
| Full Name | sperm associated antigen 5 |
| Calculated Molecular Weight | 134 kDa |
| Observed Molecular Weight | 135 kDa, 150 kDa |
| GenBank Accession Number | BC000322 |
| Gene Symbol | SPAG5 |
| Gene ID (NCBI) | 10615 |
| RRID | AB_2194787 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96R06 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SPAG5, also named as MAP126, Astrin and Deepest, is necessary for normal spindle formation during mitosis. It is highly expressed in testis. SPAG5 has different localization in somatic versus male germ cells suggesting the possibility of different function. This antibody is specific to SPAG5.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SPAG5 antibody 14726-1-AP | Download protocol |
| IHC protocol for SPAG5 antibody 14726-1-AP | Download protocol |
| IP protocol for SPAG5 antibody 14726-1-AP | Download protocol |
| WB protocol for SPAG5 antibody 14726-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Commun CDC20B is required for deuterosome-mediated centriole production in multiciliated cells. | ||
Elife Centriolar satellites assemble centrosomal microcephaly proteins to recruit CDK2 and promote centriole duplication.
| ||
Elife Kinetochores attached to microtubule-ends are stabilised by Astrin bound PP1 to ensure proper chromosome segregation. | ||
Elife CLUH controls astrin-1 expression to couple mitochondrial metabolism to cell cycle progression. | ||
Elife DIAPH3 deficiency links microtubules to mitotic errors, defective neurogenesis, and brain dysfunction. | ||
J Nanobiotechnology Fe-doped chrysotile nanotubes containing siRNAs to silence SPAG5 to treat bladder cancer. |















