• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated SPAG5 Polyclonal antibody

SPAG5 Polyclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-14726

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC, FC (Intra)

Astrin, Deepest, hMAP126, MAP126, Mitotic spindle-associated protein p126

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-14726 targets SPAG5 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag6485

Product name: Recombinant human SPAG5 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 844-1193 aa of BC000322

Sequence: TVENLTAKLASTIADNQEQDLEKTRQYSQKLGLLTEQLQSLTLFLQTKLKEKTEQETLLLSTACPPTQEHPLPNDRTFLGSILTAVADEEPESTPVPLLGSDKSAFTRVASMVSLQPAETPGMEESLAEMSIMTTELQSLCSLLQESKEEAIRTLQRKICELQARLQAQEEQHQEVQKAKEADIEKLNQALCLRYKNEKELQEVIQQQNEKILEQIDKSGELISLREEVTHLTRSLRRAETETKVLQEALAGQLDSNCQPMATNWIQEKVWLSQEVDKLRVMFLEMKNEKEKLMIKFQSHRNILEENLRRSDKELEKLDDIVQHIYKTLLSIPEVVRGCKELQGLLEFLS

Predict reactive species
Full Name sperm associated antigen 5
Calculated Molecular Weight 134 kDa
Observed Molecular Weight 135 kDa, 150 kDa
GenBank Accession NumberBC000322
Gene Symbol SPAG5
Gene ID (NCBI) 10615
RRIDAB_2919100
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ96R06
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

SPAG5, also named as MAP126, Astrin and Deepest, is necessary for normal spindle formation during mitosis. It is highly expressed in testis. SPAG5 has different localization in somatic versus male germ cells suggesting the possibility of different function. This antibody is specific to SPAG5.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 SPAG5 antibody CL488-14726Download protocol
IF protocol for CL Plus 488 SPAG5 antibody CL488-14726Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...