Product Information
83403-1-PBS targets SREBF2 in IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag28205 Product name: Recombinant human SREBF2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 375-479 aa of BC056158 Sequence: DYIKYLQQVNHKLRQENMVLKLANQKNKLLKGIDLGSLVDNEVDLKIEDFNQNVLLMSPPASDSGSQAGFSPYSIDSEPGSPLLDDAKVKDEPDSPPVALGMVDR Predict reactive species |
| Full Name | sterol regulatory element binding transcription factor 2 |
| Calculated Molecular Weight | 124 kDa |
| GenBank Accession Number | BC056158 |
| Gene Symbol | SREBF2 |
| Gene ID (NCBI) | 6721 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q12772 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
SREBF2,also named as BHLHD2, is a 1141 amino acid protein, which contains 1 bHLH domain and belongs to the SREBP family. SREBF2 localizes in the endoplasmic reticulum membrane and is ubiquitously expressed in adult and fetal tissues. SREBF2 as a transcriptional activator is required for lipid homeostasis.





