SREBF2 Recombinant monoclonal antibody

• 

  IF Staining of HeLa using 83403-1-RR

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using SREBF2 antibody (83403-1-RR, Clone: 240451A12 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  FC experiment of HeLa using 83403-1-RR

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug SREBF2 Recombinant antibody (83403-1-RR, Clone:240451A12) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• 

  Affinity and Kinetic Characterization of 83403-1-RR

  Biolayer interferometry (BLl) kinetic assays of 83403-1-RR against Human SREBF2 were performed. The affinity constant is 0.536 nM.

SREBF2 Uni-rAb^® Recombinant Antibody for IF/ICC, FC (Intra), ELISA

Cat No. 83403-1-RR

Clone No.240451A12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra), ELISA

Synonyms

240451A12, bHLHd2, Class D basic helix-loop-helix protein 2, Processed sterol regulatory element-binding protein 2, SREBF 2

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

83403-1-RR targets SREBF2 in IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag28205

  Product name: Recombinant human SREBF2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 375-479 aa of BC056158

  Sequence: DYIKYLQQVNHKLRQENMVLKLANQKNKLLKGIDLGSLVDNEVDLKIEDFNQNVLLMSPPASDSGSQAGFSPYSIDSEPGSPLLDDAKVKDEPDSPPVALGMVDR

• Full Name: sterol regulatory element binding transcription factor 2
• Calculated Molecular Weight: 124 kDa
• GenBank Accession Number: BC056158
• Gene Symbol: SREBF2
• Gene ID (NCBI): 6721
• RRID: AB_3671053
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q12772
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SREBF2,also named as BHLHD2, is a 1141 amino acid protein, which contains 1 bHLH domain and belongs to the SREBP family. SREBF2 localizes in the endoplasmic reticulum membrane and is ubiquitously expressed in adult and fetal tissues. SREBF2 as a transcriptional activator is required for lipid homeostasis.