Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

STAT1 Polyclonal antibody

STAT1 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 10144-2-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (6)

Applications

WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ChIP, RIP, ELISA, CUT&RUN

ISGF 3, Signal transducer and activator of transcription 1-alpha/beta, STAT91, Transcription factor ISGF-3 components p91/p84

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA431 cells, HEK-293 cells, A549 cells, K-562 cells, PC-3 cells
Positive IP detected inPC-3 cells
Positive IHC detected inhuman stomach tissue, human ovary cancer tissue, human testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inIFN alpha treated HeLa cells
Positive FC (Intra) detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10144-2-AP targets STAT1 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ChIP, RIP, ELISA, CUT&RUN applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse, rat, pig, rabbit, monkey, chicken
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0199

Product name: Recombinant human STAT1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 2-230 aa of BC002704

Sequence: SQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDLLSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPIQMSMIIYSCLKEERKILENAQRFNQAQSGNIQSTVMLDKQKELDSKVRNVKDKVMCIEHEIKSLEDLQDEYDFKCKTLQNREHETNGVAKSDQKQEQLLLKKMYLMLDNKRKEVVHKIIELLNVTELTQNA

Predict reactive species
Full Name signal transducer and activator of transcription 1, 91kDa
Calculated Molecular Weight 83 kDa
Observed Molecular Weight83-87 kDa
GenBank Accession NumberBC002704
Gene Symbol STAT1
Gene ID (NCBI) 6772
RRIDAB_2286875
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP42224
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

What is the molecular weight of STAT1? Are there any isoforms of STAT1? Is STAT1 post-translationally modified?

The molecular weight of STAT1 is 91 kDa for full-length STAT1α and 84 kDa for STAT1β, which is devoid of the C-terminal activation domain (PMID: 1502203). Phosphorylation of STAT1 regulates STAT1 activity. Phosphorylation of Tyr701 by Janus kinases (JAKs) triggers STAT1 homo- and hetero-dimerization with other STAT family members and also causes nuclear translocation, while phosphorylation of Ser727 is needed for full activation (PMID: 10851062). STAT1β lacks Ser727 and has therefore been considered to be inactive or acting in a dominant negative manner to STAT1α, although it has been further shown to be capable of transcription activation in vivo (PMID: 24710278).

 What is the subcellular localization of STAT1?

STAT1 is present in the cytoplasm and in the nucleus. Translocation of STAT1 from the cytoplasm to the nucleus is required for its regulation of gene expression and is dependent on phosphorylation (see above). However, low levels of unphosphorylated STAT1, often referred to as U-STAT1, can also be found in the nucleus, where U-STAT1 regulates the stability of heterochromatin by binding to chromatin in monomeric or dimeric states (PMID: 18840523).

 What is the tissue expression pattern of STAT1?

STAT1 is ubiquitously expressed.


Protocols

Product Specific Protocols
FC protocol for STAT1 antibody 10144-2-APDownload protocol
IF protocol for STAT1 antibody 10144-2-APDownload protocol
IHC protocol for STAT1 antibody 10144-2-APDownload protocol
IP protocol for STAT1 antibody 10144-2-APDownload protocol
WB protocol for STAT1 antibody 10144-2-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIF

Cell

Opioid-induced fragile-like regulatory T cells contribute to withdrawal

Authors - Yongsheng Zhu
mouse,humanWB,IF

Nat Commun

ID1 expressing macrophages support cancer cell stemness and limit CD8+ T cell infiltration in colorectal cancer

Authors - Shuang Shang
ratWB

Nat Commun

Injectable ECM-mimetic dynamic hydrogels abolish ferroptosis-induced post-discectomy herniation through delivering nucleus pulposus progenitor cell-derived exosomes

Authors - Wenkai Wang
humanWB

Sci Transl Med

TRIB3 reduces CD8+ T cell infiltration and induces immune evasion by repressing the STAT1-CXCL10 axis in colorectal cancer.

Authors - Shuang Shang
humanWB

Gut Microbes

Synergistic activity of Enterococcus Faecium-induced ferroptosis via expansion of IFN-γ+CD8+ T cell population in advanced hepatocellular carcinoma treated with sorafenib

Authors - Haitao Yu
mouseWB

Small

Cell-Free Extracts from Human Fat Tissue with a Hyaluronan-Based Hydrogel Attenuate Inflammation in a Spinal Cord Injury Model through M2 Microglia/Microphage Polarization.

Authors - Guang-Yu Xu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Margaux (Verified Customer) (10-25-2025)

I used this antibody to detect STAT1 protein in western-Blot (dilution 1/2000) in HeLa cells. It worked very well!

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/2000 in WB
  • Cell Tissue Type: HeLa cells
STAT1 Antibody Western Blot validation (1/2000 in WB dilution) in HeLa cells (Cat no:10144-2-AP)
FH

Paul (Verified Customer) (11-24-2022)

Clear band at the expected size range

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/1000
  • Cell Tissue Type: A549 LUAD cells
FH

Alejandro (Verified Customer) (08-22-2022)

Works fine for both WB, with clear bands, and IF, which shows a high specific staining

  • Applications: Western Blot, Immunofluorescence
  • Primary Antibody Dilution: 1/100 for IF and 1/1000 for WB
  • Cell Tissue Type: Mouse embrionary fibroblasts
FH

Slavica (Verified Customer) (10-04-2021)

The antibody worked very well!!!

  • Applications: Western Blot
  • Cell Tissue Type: SHED cell lines
Loading...
||
New chat

Able

正在加载,请稍候...