• Featured Product
  • KD/KO Validated

STAT3 Monoclonal antibody

STAT3 Monoclonal Antibody for WB, IHC, IF/ICC, IP, ELISA
Cat No. 60199-1-Ig
Clone No.3G2D12

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

3G2D12, Acute-phase response factor, APRF, HIES, STAT 3

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, Jurkat cells, RAW 264.7 cells, rat brain tissue
Positive IP detected inHeLa cells
Positive IHC detected inhuman cervical cancer tissue, human endometrial cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:200-1:1000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

60199-1-Ig targets STAT3 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, zebrafish, bovine
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag0360

Product name: Recombinant human STAT3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 2-219 aa of BC000627

Sequence: AQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVS

Predict reactive species
Full Name signal transducer and activator of transcription 3 (acute-phase response factor)
Calculated Molecular Weight 770 aa, 88 kDa
Observed Molecular Weight85-88 kDa
GenBank Accession NumberBC000627
Gene Symbol STAT3
Gene ID (NCBI) 6774
RRIDAB_10913811
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP40763
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Signal transducer and activator of transcription 3 (acute-phase response factor) (STAT3, synonyms: APRF, FLJ20882, MGC16063) is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. STAT3 is activated through phosphorylation in response to various cytokines and growth factors including IFNs, EGF, IL5, IL6, HGF, LIF and BMP2. STAT3 mediates the expression of a variety of genes in response to cell stimuli, and thus plays a key role in many cellular processes such as cell growth and apoptosis. The small GTPase Rac1 has been shown to bind and regulate the activity of STAT3. This antibody is a mouse monoclonal antibody raised against residues near the N terminus of human STAT3. STAT3 exists three isoforms and the molecular weight of each isoform respectively is 83 kDa, 87 kDa and 88 kDa.

Protocols

Product Specific Protocols
WB protocol for STAT3 antibody 60199-1-IgDownload protocol
IHC protocol for STAT3 antibody 60199-1-IgDownload protocol
IF protocol for STAT3 antibody 60199-1-IgDownload protocol
IP protocol for STAT3 antibody 60199-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB,IF

ACS Nano

Dual Inhibition of Endoplasmic Reticulum Stress and Oxidation Stress Manipulates the Polarization of Macrophages under Hypoxia to Sensitize Immunotherapy.

Authors - Mengshi Jiang
humanWB

J Immunother Cancer

Switch receptor T3/28 improves long-term persistence and antitumor efficacy of CAR-T cells

Authors - Songbo Zhao
mouseWB

Theranostics

Combination therapy with ropivacaine-loaded liposomes and nutrient deprivation for simultaneous cancer therapy and cancer pain relief.

Authors - Jiqian Zhang
CoIP

JCI Insight

PKM2-mediated collagen XVII expression is critical for wound repair

Authors - Yangdan Liu
mouseWB

Clin Transl Med

PRKAR2A-derived circular RNAs promote the malignant transformation of colitis and distinguish patients with colitis-associated colorectal cancer.

Authors - Daiwei Wan
mouseWB

Elife

Upregulated expression of ubiquitin ligase TRIM21 promotes PKM2 nuclear translocation and astrocyte activation in experimental autoimmune encephalomyelitis

Authors - Luting Yang
Loading...
||
New chat Able
正在加载,请稍候...