• Featured Product
  • KD/KO Validated

CoraLite® Plus 647-conjugated STAT3 Monoclonal antibody

STAT3 Monoclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL647-60199
Clone No.3G2D12

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

3G2D12, Acute-phase response factor, APRF, HIES, STAT 3

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHepG2 cells, HeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL647-60199 targets STAT3 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag0360

Product name: Recombinant human STAT3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 2-219 aa of BC000627

Sequence: AQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVS

Predict reactive species
Full Name signal transducer and activator of transcription 3 (acute-phase response factor)
Calculated Molecular Weight 770 aa, 88 kDa
Observed Molecular Weight 88 kDa
GenBank Accession NumberBC000627
Gene Symbol STAT3
Gene ID (NCBI) 6774
RRIDAB_2920245
Conjugate CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP40763
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Signal transducer and activator of transcription 3 (acute-phase response factor) (STAT3, synonyms: APRF, FLJ20882, MGC16063) is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. STAT3 is activated through phosphorylation in response to various cytokines and growth factors including IFNs, EGF, IL5, IL6, HGF, LIF and BMP2. STAT3 mediates the expression of a variety of genes in response to cell stimuli, and thus plays a key role in many cellular processes such as cell growth and apoptosis. The small GTPase Rac1 has been shown to bind and regulate the activity of STAT3. This antibody is a mouse monoclonal antibody raised against residues near the N terminus of human STAT3. STAT3 exists three isoforms and the molecular weight of each isoform respectively is 83 kDa, 87 kDa and 88 kDa.

Protocols

Product Specific Protocols
FC protocol for CL Plus 647 STAT3 antibody CL647-60199Download protocol
IF protocol for CL Plus 647 STAT3 antibody CL647-60199Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...