Tested Applications
Positive WB detected in | pig brain tissue, rat brain tissue, fetal human brain tissue, Y79 cells, rabbit brain tissue, mouse brain tissue |
Positive IHC detected in | rat brain tissue, human brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF-P detected in | mouse brain tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:5000-1:40000 |
Immunohistochemistry (IHC) | IHC : 1:2000-1:8000 |
Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 10 publications below |
IF | See 2 publications below |
Product Information
66437-1-Ig targets Syntaxin 1B in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.
Tested Reactivity | human, mouse, rat, pig, rabbit |
Cited Reactivity | human, mouse, rat |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag10257 Product name: Recombinant human STX1B protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-263 aa of BC062298 Sequence: MKDRTQELRSAKDSDDEEEVVHVDRDHFMDEFFEQVEEIRGCIEKLSEDVEQVKKQHSAILAAPNPDEKTKQELEDLTADIKKTANKVRSKLKAIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMTEYNATQSKYRDRCKDRIQRQLEITGRTTTNEELEDMLESGKLAIFTDDIKMDSQMTKQALNEIETRHNEIIKLETSIRELHDMFVDMAMLVESQGEMIDRIEYNVEHSVDYVERAVSDTKKAVKYQSKARRK Predict reactive species |
Full Name | syntaxin 1B |
Calculated Molecular Weight | 288 aa, 33 kDa |
Observed Molecular Weight | 33 kDa, 55 kDa |
GenBank Accession Number | BC062298 |
Gene Symbol | STX1B |
Gene ID (NCBI) | 112755 |
RRID | AB_2881807 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | P61266 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Syntaxins are a family of transmembrane proteins that belong to the SNARE complex (PMID: 11737951). In conjunction with other SNAREs and with the cytoplasmic NSF and SNAP proteins, syntaxins mediate vesicle fusion in diverse vesicular transport processes along the exocytic and the endocytic pathway (PMID: 11737951). Syntaxin 1A and 1B, two closely related isoforms of syntaxin 1, are involved in synaptic vesicle docking and fusion during neurotransmitter release (PMID: 7690687; 1321498; 18691641). This antibody raised against 1-263 aa of human syntaxin 1B detects a ~33 kDa band of syntaxin 1 and an additional band of 55-60 kDa, which probably represents a syntaxin 1 dimer (PMID: 10100611). This antibody may react with both Syntaxin 1B and Syntaxin 1A.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for Syntaxin 1B antibody 66437-1-Ig | Download protocol |
IHC protocol for Syntaxin 1B antibody 66437-1-Ig | Download protocol |
IF protocol for Syntaxin 1B antibody 66437-1-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Nat Commun Identification of genes associated with cortical malformation using a transposon-mediated somatic mutagenesis screen in mice.
| ||
J Neuroinflammation Transient neuroinflammation following surgery contributes to long-lasting cognitive decline in elderly rats via dysfunction of synaptic NMDA receptor. | ||
Clin Sci (Lond) Chronic hepatitis C virus infection impairs insulin secretion by regulation of p38δ MAPK-dependent exocytosis in pancreatic β-cells. | ||
Brain Commun Transcriptomic analysis of human brains with Alzheimer's disease reveals the altered expression of synaptic genes linked to cognitive deficits. | ||
Nat Commun Munc18 and Munc13 serve as a functional template to orchestrate neuronal SNARE complex assembly. | ||
Neurotoxicology Heterozygous disruption of beclin 1 alleviates neurotoxicity induced by sub-chronic exposure of arsenite in mice |