• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated Syntaxin 1A / Syntaxin 1B Monoclonal antibody

Syntaxin 1A / Syntaxin 1B Monoclonal Antibody for IF-P
Cat No. CL488-66437
Clone No.2D3B5

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

IF-P

Syntaxin 1B, STX1B, Syntaxin 1A, 2D3B5, STX1B1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse brain tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66437 targets Syntaxin 1A / Syntaxin 1B in IF-P applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag10257

Product name: Recombinant human STX1B protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-263 aa of BC062298

Sequence: MKDRTQELRSAKDSDDEEEVVHVDRDHFMDEFFEQVEEIRGCIEKLSEDVEQVKKQHSAILAAPNPDEKTKQELEDLTADIKKTANKVRSKLKAIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMTEYNATQSKYRDRCKDRIQRQLEITGRTTTNEELEDMLESGKLAIFTDDIKMDSQMTKQALNEIETRHNEIIKLETSIRELHDMFVDMAMLVESQGEMIDRIEYNVEHSVDYVERAVSDTKKAVKYQSKARRK

Predict reactive species
Full Name syntaxin 1B
Calculated Molecular Weight 288 aa, 33 kDa
Observed Molecular Weight 33 kDa
GenBank Accession NumberBC062298
Gene Symbol STX1B
Gene ID (NCBI) 112755
RRIDAB_2919324
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP61266
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Syntaxins are a family of transmembrane proteins that belong to the SNARE complex (PMID: 11737951). In conjunction with other SNAREs and with the cytoplasmic NSF and SNAP proteins, syntaxins mediate vesicle fusion in diverse vesicular transport processes along the exocytic and the endocytic pathway (PMID: 11737951). Syntaxin 1A and 1B, two closely related isoforms of syntaxin 1, are involved in synaptic vesicle docking and fusion during neurotransmitter release (PMID: 7690687; 1321498; 18691641).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 Syntaxin 1A / Syntaxin 1B antibody CL488-66437Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...