• Featured Product
  • KD/KO Validated

Syntaxin 1B Monoclonal antibody, PBS Only

Syntaxin 1B Monoclonal Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 66437-1-PBS
Clone No.2D3B5

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, IHC, IF-P, Indirect ELISA

Syntaxin 1A / Syntaxin 1B, Syntaxin 1B, STX1B, Syntaxin 1A, 2D3B5

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66437-1-PBS targets Syntaxin 1B in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

Tested Reactivity human, mouse, rat, pig, rabbit
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag10257

Product name: Recombinant human STX1B protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-263 aa of BC062298

Sequence: MKDRTQELRSAKDSDDEEEVVHVDRDHFMDEFFEQVEEIRGCIEKLSEDVEQVKKQHSAILAAPNPDEKTKQELEDLTADIKKTANKVRSKLKAIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMTEYNATQSKYRDRCKDRIQRQLEITGRTTTNEELEDMLESGKLAIFTDDIKMDSQMTKQALNEIETRHNEIIKLETSIRELHDMFVDMAMLVESQGEMIDRIEYNVEHSVDYVERAVSDTKKAVKYQSKARRK

Predict reactive species
Full Name syntaxin 1B
Calculated Molecular Weight 288 aa, 33 kDa
Observed Molecular Weight 33 kDa, 55 kDa
GenBank Accession NumberBC062298
Gene Symbol STX1B
Gene ID (NCBI) 112755
RRIDAB_2881807
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP61266
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Syntaxins are a family of transmembrane proteins that belong to the SNARE complex (PMID: 11737951). In conjunction with other SNAREs and with the cytoplasmic NSF and SNAP proteins, syntaxins mediate vesicle fusion in diverse vesicular transport processes along the exocytic and the endocytic pathway (PMID: 11737951). Syntaxin 1A and 1B, two closely related isoforms of syntaxin 1, are involved in synaptic vesicle docking and fusion during neurotransmitter release (PMID: 7690687; 1321498; 18691641). This antibody raised against 1-263 aa of human syntaxin 1B detects a ~33 kDa band of syntaxin 1 and an additional band of 55-60 kDa, which probably represents a syntaxin 1 dimer (PMID: 10100611). This antibody may react with both Syntaxin 1B and Syntaxin 1A.

Loading...
||
New chat

Able

正在加载,请稍候...