• Featured Product
  • KD/KO Validated

Syntaxin 1B Monoclonal antibody

Syntaxin 1B Monoclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 66437-1-Ig
Clone No.2D3B5

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, IHC, IF-P, ELISA

Syntaxin 1A / Syntaxin 1B, Syntaxin 1B, STX1B, Syntaxin 1A, 2D3B5

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inpig brain tissue, fetal human brain tissue, rat brain tissue, Y79 cells, rabbit brain tissue, mouse brain tissue
Positive IHC detected inrat brain tissue, human brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse brain tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:40000
Immunohistochemistry (IHC)IHC : 1:2000-1:8000
Immunofluorescence (IF)-PIF-P : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66437-1-Ig targets Syntaxin 1B in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

Tested Reactivity human, mouse, rat, pig, rabbit
Cited Reactivityhuman, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag10257

Product name: Recombinant human STX1B protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-263 aa of BC062298

Sequence: MKDRTQELRSAKDSDDEEEVVHVDRDHFMDEFFEQVEEIRGCIEKLSEDVEQVKKQHSAILAAPNPDEKTKQELEDLTADIKKTANKVRSKLKAIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMTEYNATQSKYRDRCKDRIQRQLEITGRTTTNEELEDMLESGKLAIFTDDIKMDSQMTKQALNEIETRHNEIIKLETSIRELHDMFVDMAMLVESQGEMIDRIEYNVEHSVDYVERAVSDTKKAVKYQSKARRK

Predict reactive species
Full Name syntaxin 1B
Calculated Molecular Weight 288 aa, 33 kDa
Observed Molecular Weight 33 kDa, 55 kDa
GenBank Accession NumberBC062298
Gene Symbol STX1B
Gene ID (NCBI) 112755
RRIDAB_2881807
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP61266
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Syntaxins are a family of transmembrane proteins that belong to the SNARE complex (PMID: 11737951). In conjunction with other SNAREs and with the cytoplasmic NSF and SNAP proteins, syntaxins mediate vesicle fusion in diverse vesicular transport processes along the exocytic and the endocytic pathway (PMID: 11737951). Syntaxin 1A and 1B, two closely related isoforms of syntaxin 1, are involved in synaptic vesicle docking and fusion during neurotransmitter release (PMID: 7690687; 1321498; 18691641). This antibody raised against 1-263 aa of human syntaxin 1B detects a ~33 kDa band of syntaxin 1 and an additional band of 55-60 kDa, which probably represents a syntaxin 1 dimer (PMID: 10100611). This antibody may react with both Syntaxin 1B and Syntaxin 1A.

Protocols

Product Specific Protocols
IF protocol for Syntaxin 1B antibody 66437-1-IgDownload protocol
IHC protocol for Syntaxin 1B antibody 66437-1-IgDownload protocol
WB protocol for Syntaxin 1B antibody 66437-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB,IF

Nat Commun

Identification of genes associated with cortical malformation using a transposon-mediated somatic mutagenesis screen in mice.

Authors - I-Ling Lu
  • KD Validated
ratWB

J Neuroinflammation

Transient neuroinflammation following surgery contributes to long-lasting cognitive decline in elderly rats via dysfunction of synaptic NMDA receptor.

Authors - Bo Chen
mouseWB

Clin Sci (Lond)

Chronic hepatitis C virus infection impairs insulin secretion by regulation of p38δ MAPK-dependent exocytosis in pancreatic β-cells.

Authors - Jizheng Chen
humanWB,IF

Brain Commun

Transcriptomic analysis of human brains with Alzheimer's disease reveals the altered expression of synaptic genes linked to cognitive deficits.

Authors - Jamal B Williams
ratWB

Nat Commun

Munc18 and Munc13 serve as a functional template to orchestrate neuronal SNARE complex assembly.

Authors - Shen Wang
mouseWB

Aging (Albany NY)

Longitudinal characterization of behavioral, morphological and transcriptomic changes in a tauopathy mouse model

Authors - Qing Cao
Loading...
||
New chat

Able

正在加载,请稍候...