CoraLite® Plus 647-conjugated Septin 11 Polyclonal antibody

• 

  IF Staining of HeLa using CL647-14672

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using CoraLite® Plus 647 Septin 11 antibody (CL647-14672) at dilution of 1:200.

• 

  FC experiment of HeLa using CL647-14672

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug CoraLite® Plus 647 Anti-Human Septin 11 (CL647-14672) (red), or 0.4 ug Isotype Control. Cells were fixed with 4% PFA and permeabilized with Intracellular Staining Permeabilization Wash Buffer.

Septin 11 Polyclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL647-14672

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

Synonyms

SEPT11, septin 11

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells
• Positive FC (Intra) detected in: HeLa cells
• Positive FC detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
• Flow Cytometry (FC): FC : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL647-14672 targets Septin 11 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6342

  Product name: Recombinant human SEPT11 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-150 aa of BC063615

  Sequence: MAVAVGRPSNEELRNLSLSGHVGFDSLPDQLVNKSTSQGFCFNILCVGETGIGKSTLMDTLFNTKFESDPATHNEPGVRLKARSYELQESNVRLKLTIVDTVGFGDQINKDDSYKPIVEYIDAQFEAYLQEELKIKRSLFNYHDTRIHAC

• Full Name: septin 11
• Calculated Molecular Weight: 49 kDa
• GenBank Accession Number: BC063615
• Gene Symbol: Septin 11
• Gene ID (NCBI): 55752
• RRID: AB_3084803
• Conjugate: CoraLite® Plus 647 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 654 nm / 674 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NVA2
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.