Septin 11 Polyclonal antibody

• 

  WB analysis of human brain using 14672-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 14672-1-AP (Septin 11 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 14672-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 14672-1-AP (Septin 11 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 14672-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 14672-1-AP (Septin 11 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HT-1080 using 14672-1-AP

  HT-1080 cells were subjected to SDS PAGE followed by western blot with 14672-1-AP (Septin 11 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse small intestine using 14672-1-AP

  mouse small intestine tissue were subjected to SDS PAGE followed by western blot with 14672-1-AP (Septin 11 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse colon using 14672-1-AP

  mouse colon tissue were subjected to SDS PAGE followed by western blot with 14672-1-AP (Septin 11 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of SH-SY5Y using 14672-1-AP

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 14672-1-AP (Septin 11 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse brain using 14672-1-AP

  IP result of anti-Septin 11 (IP:14672-1-AP, 4ug; Detection:14672-1-AP 1:500) with mouse brain tissue lysate 3440ug.

• 

  IHC staining of human ovary using 14672-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary using 14672-1-AP (Septin 11 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human ovary using 14672-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary using 14672-1-AP (Septin 11 antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human spleen using 14672-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen using 14672-1-AP (Septin 11 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human spleen using 14672-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen using 14672-1-AP (Septin 11 antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human lung using 14672-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung using 14672-1-AP (Septin 11 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human lung using 14672-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung using 14672-1-AP (Septin 11 antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human kidney using 14672-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 14672-1-AP (Septin 11 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human kidney using 14672-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 14672-1-AP (Septin 11 antibody) at dilution of 1:50 (under 40x lens).

• 

  IF Staining of HeLa using 14672-1-AP

  Immunofluorescent analysis of Hela cells, using Septin 11 antibody 14672-1-AP at 1:50 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). Blue pseudocolor = DAPI (fluorescent DNA dye).

• 

  IF Staining of HepG2 using 14672-1-AP

  Immunofluorescent analysis of HepG2 cells, using Septin 11 antibody 14672-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). Blue pseudocolor = DAPI (fluorescent DNA dye).

• 

  IF Staining of HeLa using 14672-1-AP

  Immunofluorescent analysis of Hela cells, using Septin 11 antibody 14672-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red).

• 

  FC experiment of HeLa using 14672-1-AP

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug Anti-Human Septin 11 (14672-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Isotype Control. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

Septin 11 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 14672-1-AP

Publications(6)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), IP, CoIP, RIP, ELISA

Synonyms

SEPT11, SEPTIN11, Septin-11

---

Tested Applications

• Positive WB detected in: human brain tissue, HeLa cells, HT-1080 cells, mouse brain tissue, mouse colon tissue, mouse small intestine tissue, SH-SY5Y cells
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: human ovary tissue, human kidney tissue, human lung tissue, human spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: Hela cells, HepG2 cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below
• IF: See 4 publications below
• IP: See 1 publications below
• CoIP: See 1 publications below
• RIP: See 1 publications below

Product Information

14672-1-AP targets Septin 11 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6342

  Product name: Recombinant human SEPT11 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-150 aa of BC063615

  Sequence: MAVAVGRPSNEELRNLSLSGHVGFDSLPDQLVNKSTSQGFCFNILCVGETGIGKSTLMDTLFNTKFESDPATHNEPGVRLKARSYELQESNVRLKLTIVDTVGFGDQINKDDSYKPIVEYIDAQFEAYLQEELKIKRSLFNYHDTRIHAC

• Full Name: septin 11
• Calculated Molecular Weight: 49 kDa
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: BC063615
• Gene Symbol: Septin 11
• Gene ID (NCBI): 55752
• RRID: AB_2301682
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NVA2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	RIP	Cancer Res; CircFOXK2 Promotes Growth and Metastasis of Pancreatic Ductal Adenocarcinoma by Complexing with RNA Binding Proteins and Sponging MiR-942.; Authors - Chi Hin Wong
mouse	IF	Cytoskeleton (Hoboken); Characterization of septin expression in normal and fibrotic kidneys.; Authors - Katharina Neubauer
human	WB,IF	Cell Rep; An anillin-CIN85-SEPT9 complex promotes intercellular bridge maturation required for successful cytokinesis; Authors - Thomas C Panagiotou
human	WB	Cancers (Basel); Forchlorfenuron-Induced Mitochondrial Respiration Inhibition and Metabolic Shifts in Endometrial Cancer; Authors - Kyukwang Kim
mouse,human	WB,IP,IF,CoIP	Cell Death Dis; Septin11 promotes hepatocellular carcinoma cell motility by activating RhoA to regulate cytoskeleton and cell adhesion; Authors - Lisheng Fu
mouse,human	IF	Nat Commun; Quantitative determination of the spatial distribution of components in single cells with CellDetail; Authors - Tanja Schuster