Tested Applications
| Positive WB detected in | PC-12 cells, pig brain tissue, rabbit brain tissue, rat brain tissue, mouse brain tissue, pig cerebellum tissue, rabbit cerebellum tissue, rat cerebellum tissue, mouse cerebellum tissue |
| Positive IHC detected in | mouse brain tissue, human rectal cancer tissue, rat pancreas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse pancreas tissue, mouse brain tissue |
| Positive IF-Fro detected in | rat brain tissue |
| Positive IF/ICC detected in | SH-SY5Y cells, PC-12 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:20000-1:100000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Immunofluorescence (IF)-FRO | IF-FRO : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:250-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 12 publications below |
| IHC | See 2 publications below |
| IF | See 10 publications below |
Product Information
67864-1-Ig targets Synaptophysin in WB, IHC, IF/ICC, IF-P, IF-Fro, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.
| Tested Reactivity | human, mouse, rat, pig, rabbit |
| Cited Reactivity | human, mouse, rat, pig |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag11803 Product name: Recombinant human Synaptophysin; SYP protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 50-313 aa of BC064550 Sequence: ELQLSVDCANKTESDLSIEVEFEYPFRLHQVYFDAPTCRGGTTKVFLVGDYSSSAEFFVTVAVFAFLYSMGALATYIFLQNKYRENNKGPMLDFLATAVFAFMWLVSSSAWAKGLSDVKMATDPENIIKEMPVCRQTGNTCKELRDLVTSGLNTSVVFGFLNLVLWVGNLWFVFKETGWAAPFLRAPPGAPEKQPAPGDAYGDAGYGQGPGGYGPQDSYGPQGGYQPDYGQPAGSGGSGYGPQGDYGQQGYGPQGAPTSFSNQM Predict reactive species |
| Full Name | synaptophysin |
| Calculated Molecular Weight | 313 aa, 34 kDa |
| Observed Molecular Weight | 38 kDa |
| GenBank Accession Number | BC064550 |
| Gene Symbol | Synaptophysin |
| Gene ID (NCBI) | 6855 |
| RRID | AB_2918622 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P08247 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Synaptophysin (SYP, also known as major synaptic vesicle protein p38) is a 38-kDa integral membrane glycoprotein that regulates synaptic vesicle endocytosis. It is the most abundant synaptic vesicle protein by mass. Synaptophysin is present in neuroendocrine cells and neurons that participate in synaptic transmission. Synaptophysin is a useful marker for identification of neuroendocrine cells and neoplasms. (PMID: 3010302; 21658579)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Synaptophysin antibody 67864-1-Ig | Download protocol |
| IHC protocol for Synaptophysin antibody 67864-1-Ig | Download protocol |
| WB protocol for Synaptophysin antibody 67864-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Adv Mater Noninvasive Optogenetics Realized by iPSC-Derived Tentacled Carrier in Alzheimer's Disease Treatment | ||
J Agric Food Chem 20(S)-Protopanaxadiol Exerts Antidepressive Effects in Chronic Corticosterone-Induced Rodent Animal Models as an Activator of Brain-Type Creatine Kinase | ||
Front Cell Neurosci Expression of SH3 and Multiple Ankyrin Repeat Domains Protein 3 in Mouse Retina. | ||
Psychiatry Res The role of reelin in the pathological mechanism of depression from clinical to rodents | ||
Alzheimers Dement Reduced synaptic proteins and SNARE complexes in Down syndrome with Alzheimer's disease and the Dp16 mouse Down syndrome model: Impact of APP gene dose | ||
Neurochem Int Photobiomodulation treatment inhibits neurotoxic astrocytic polarization and protects neurons in in vitro and in vivo stroke models |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH B (Verified Customer) (01-05-2022) | Good performance in WB with a strong and clear band at 35 Kd around.
![]() |
























