Synaptophysin Monoclonal antibody

Synaptophysin Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, IF-Fro, ELISA
Cat No. 67864-1-Ig
Clone No.4E12C4

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, IHC, IF/ICC, IF-P, IF-Fro, ELISA

SYP, 4E12C4, MRX96, SYN

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inPC-12 cells, pig brain tissue, rabbit brain tissue, rat brain tissue, mouse brain tissue, pig cerebellum tissue, rabbit cerebellum tissue, rat cerebellum tissue, mouse cerebellum tissue
Positive IHC detected inmouse brain tissue, human rectal cancer tissue, rat pancreas tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse pancreas tissue, mouse brain tissue
Positive IF-Fro detected inrat brain tissue
Positive IF/ICC detected inSH-SY5Y cells, PC-12 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:20000-1:100000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Immunofluorescence (IF)-FROIF-FRO : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:250-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67864-1-Ig targets Synaptophysin in WB, IHC, IF/ICC, IF-P, IF-Fro, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

Tested Reactivity human, mouse, rat, pig, rabbit
Cited Reactivityhuman, mouse, rat, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag11803

Product name: Recombinant human Synaptophysin; SYP protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 50-313 aa of BC064550

Sequence: ELQLSVDCANKTESDLSIEVEFEYPFRLHQVYFDAPTCRGGTTKVFLVGDYSSSAEFFVTVAVFAFLYSMGALATYIFLQNKYRENNKGPMLDFLATAVFAFMWLVSSSAWAKGLSDVKMATDPENIIKEMPVCRQTGNTCKELRDLVTSGLNTSVVFGFLNLVLWVGNLWFVFKETGWAAPFLRAPPGAPEKQPAPGDAYGDAGYGQGPGGYGPQDSYGPQGGYQPDYGQPAGSGGSGYGPQGDYGQQGYGPQGAPTSFSNQM

Predict reactive species
Full Name synaptophysin
Calculated Molecular Weight 313 aa, 34 kDa
Observed Molecular Weight38 kDa
GenBank Accession NumberBC064550
Gene Symbol Synaptophysin
Gene ID (NCBI) 6855
RRIDAB_2918622
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP08247
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Synaptophysin (SYP, also known as major synaptic vesicle protein p38) is a 38-kDa integral membrane glycoprotein that regulates synaptic vesicle endocytosis. It is the most abundant synaptic vesicle protein by mass. Synaptophysin is present in neuroendocrine cells and neurons that participate in synaptic transmission. Synaptophysin is a useful marker for identification of neuroendocrine cells and neoplasms. (PMID: 3010302; 21658579)

Protocols

Product Specific Protocols
IF protocol for Synaptophysin antibody 67864-1-IgDownload protocol
IHC protocol for Synaptophysin antibody 67864-1-IgDownload protocol
WB protocol for Synaptophysin antibody 67864-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB,IHC,IF

Adv Mater

Noninvasive Optogenetics Realized by iPSC-Derived Tentacled Carrier in Alzheimer's Disease Treatment

Authors - Yuewen Zhai
mouseWB

J Agric Food Chem

20(S)-Protopanaxadiol Exerts Antidepressive Effects in Chronic Corticosterone-Induced Rodent Animal Models as an Activator of Brain-Type Creatine Kinase

Authors - Zhu Zhu
mouseIF

Front Cell Neurosci

Expression of SH3 and Multiple Ankyrin Repeat Domains Protein 3 in Mouse Retina.

Authors - Yue Xu

Nat Protoc

Highly stable planar asymmetric suspended membranes for investigating protein dynamics and membrane fusion

Authors - Manindra Bera
ratIF

Drug Des Devel Ther

Jujuboside A Regulates Calcium Homeostasis and Structural Plasticity to Alleviate Depression-Like Behavior via Shh Signaling in Immature Neurons

Authors - Ziyan Zhong
ratIF

BMC Complement Med Ther

A whole transcriptome profiling analysis for antidepressant mechanism of Xiaoyaosan mediated synapse loss via BDNF/trkB/PI3K signal axis in CUMS rats

Authors - Pan Meng

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

B (Verified Customer) (01-05-2022)

Good performance in WB with a strong and clear band at 35 Kd around.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:5000
  • Cell Tissue Type: mouse brain lysate
Synaptophysin Antibody Western Blot validation (1:5000 dilution) in mouse brain lysate (Cat no:67864-1-Ig)
Loading...
||
New chat Able
正在加载,请稍候...