Tested Applications
Positive WB detected in | HaCaT cells |
Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF-P detected in | mouse skin tissue |
Positive IF/ICC detected in | HaCaT cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:5000 |
Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
68141-1-Ig targets TACSTD2/TROP2 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Host / Isotype | Mouse / IgG2b |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag25775 Product name: Recombinant human TACSTD2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 138-215 aa of BC009409 Sequence: KGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAG Predict reactive species |
Full Name | tumor-associated calcium signal transducer 2 |
Calculated Molecular Weight | 36 kDa |
Observed Molecular Weight | 40-50 kDa |
GenBank Accession Number | BC009409 |
Gene Symbol | TROP2 |
Gene ID (NCBI) | 4070 |
RRID | AB_3085043 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P09758 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Trophoblast cell surface antigen 2 (TROP2), also named as TACSTD2, is a transmembrane glycoprotein. TROP2 plays a role in transducing intracellular calcium signals. It is expressed in trophoblast cells, cornea and multi-stratified epithelia. TROP2 is overexpressed in most carcinomas and is involved in cancer proliferation, migration, invasion, and metastasis. Congenital mutations of TROP2 cause a rare autosomal recessive disease which may lead to blindness-the gelatinous drop-like corneal disease (PMID: 35688908).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for TACSTD2/TROP2 antibody 68141-1-Ig | Download protocol |
IHC protocol for TACSTD2/TROP2 antibody 68141-1-Ig | Download protocol |
IF protocol for TACSTD2/TROP2 antibody 68141-1-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |