CoraLite® Plus 488-conjugated TACSTD2/TROP2 Monoclonal antibody

• 

  IF Staining of HaCaT using CL488-68141

  Immunofluorescent analysis of (-20°C Methanol) fixed HaCaT cells using CoraLite® Plus 488 TACSTD2/TROP2 antibody (CL488-68141, Clone: 5A6B1 ) at dilution of 1:200.

TACSTD2/TROP2 Monoclonal Antibody for IF/ICC

Cat No. CL488-68141

Clone No.5A6B1

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

IF/ICC

Synonyms

TACSTD2, GA733-1, GA733 1, GA733, EGP 1

---

Tested Applications

• Positive IF/ICC detected in: HaCaT cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-68141 targets TACSTD2/TROP2 in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25775

  Product name: Recombinant human TACSTD2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 138-215 aa of BC009409

  Sequence: KGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAG

• Full Name: tumor-associated calcium signal transducer 2
• Calculated Molecular Weight: 36 kDa
• Observed Molecular Weight: 40-50 kDa
• GenBank Accession Number: BC009409
• Gene Symbol: TROP2
• Gene ID (NCBI): 4070
• RRID: AB_3672974
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P09758
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Trophoblast cell surface antigen 2 (TROP2), also named as TACSTD2, is a transmembrane glycoprotein. TROP2 plays a role in transducing intracellular calcium signals. It is expressed in trophoblast cells, cornea and multi-stratified epithelia. TROP2 is overexpressed in most carcinomas and is involved in cancer proliferation, migration, invasion, and metastasis. Congenital mutations of TROP2 cause a rare autosomal recessive disease which may lead to blindness-the gelatinous drop-like corneal disease (PMID: 35688908).