TACSTD2/TROP2 Monoclonal antibody, PBS Only

• 

  WB analysis of HaCaT using 68141-1-Ig (same clone as 68141-1-PBS)

  HaCaT cells were subjected to SDS PAGE followed by western blot with 68141-1-Ig (TACSTD2/TROP2 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68141-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 68141-1-Ig (same clone as 68141-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 68141-1-Ig (TACSTD2/TROP2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68141-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 68141-1-Ig (same clone as 68141-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 68141-1-Ig (TACSTD2/TROP2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68141-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human cervical cancer using 68141-1-Ig (same clone as 68141-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 68141-1-Ig (TACSTD2 antibody) at dilution of 1:16000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68141-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse skin using 68141-1-Ig (same clone as 68141-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse skin tissue using TACSTD2/TROP2 antibody (68141-1-Ig, Clone: 5A6B1 ) at dilution of 1:100 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68141-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HaCaT using 68141-1-Ig (same clone as 68141-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HaCaT cells using TACSTD2/TROP2 antibody (68141-1-Ig, Clone: 5A6B1 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 68141-1-PBS in a different storage buffer formulation.

TACSTD2/TROP2 Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, Indirect ELISA

Cat No. 68141-1-PBS

Clone No.5A6B1

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IF-P, Indirect ELISA

Synonyms

TACSTD2, 5A6B1, Cell surface glycoprotein Trop-2, EGP 1, GA733

---

Product Information

68141-1-PBS targets TACSTD2/TROP2 in WB, IHC, IF/ICC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25775

  Product name: Recombinant human TACSTD2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 138-215 aa of BC009409

  Sequence: KGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAG

• Full Name: tumor-associated calcium signal transducer 2
• Calculated Molecular Weight: 36 kDa
• Observed Molecular Weight: 40-50 kDa
• GenBank Accession Number: BC009409
• Gene Symbol: TROP2
• Gene ID (NCBI): 4070
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P09758
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Trophoblast cell surface antigen 2 (TROP2), also named as TACSTD2, is a transmembrane glycoprotein. TROP2 plays a role in transducing intracellular calcium signals. It is expressed in trophoblast cells, cornea and multi-stratified epithelia. TROP2 is overexpressed in most carcinomas and is involved in cancer proliferation, migration, invasion, and metastasis. Congenital mutations of TROP2 cause a rare autosomal recessive disease which may lead to blindness-the gelatinous drop-like corneal disease (PMID: 35688908).