Product Information
68141-1-PBS targets TACSTD2/TROP2 in WB, IHC, IF/ICC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Host / Isotype | Mouse / IgG2b |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag25775 Product name: Recombinant human TACSTD2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 138-215 aa of BC009409 Sequence: KGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAG Predict reactive species |
Full Name | tumor-associated calcium signal transducer 2 |
Calculated Molecular Weight | 36 kDa |
Observed Molecular Weight | 40-50 kDa |
GenBank Accession Number | BC009409 |
Gene Symbol | TROP2 |
Gene ID (NCBI) | 4070 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P09758 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
Trophoblast cell surface antigen 2 (TROP2), also named as TACSTD2, is a transmembrane glycoprotein. TROP2 plays a role in transducing intracellular calcium signals. It is expressed in trophoblast cells, cornea and multi-stratified epithelia. TROP2 is overexpressed in most carcinomas and is involved in cancer proliferation, migration, invasion, and metastasis. Congenital mutations of TROP2 cause a rare autosomal recessive disease which may lead to blindness-the gelatinous drop-like corneal disease (PMID: 35688908).